PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00220.1_g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10366 Da PI: 10.303 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.8 | 1.9e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEd++l ++++ G g+W++ ++ g++R++k+c++rw +yl Rsa1.0_00220.1_g00010.1 15 KGPWMPEEDDKLRAYINKKGYGNWRSLPKLAGLNRCGKSCRLRWMNYL 62 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-23 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.935 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.26E-21 | 16 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.51E-9 | 17 | 62 | No hit | No description |
PROSITE profile | PS50090 | 3.984 | 63 | 89 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-7 | 66 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRSPCCDQE KGVKKGPWMP EEDDKLRAYI NKKGYGNWRS LPKLAGLNRC GKSCRLRWMN 60 YLRPNIRRGE FSNEEESNIV RLHAILGNK |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00220.1_g00010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC183492 | 4e-92 | AC183492.1 Brassica oleracea Contig G, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009108343.1 | 2e-56 | PREDICTED: transcription factor MYB39-like | ||||
Refseq | XP_013654758.1 | 2e-56 | transcription factor MYB39-like | ||||
Swissprot | Q8GWP0 | 6e-55 | MYB39_ARATH; Transcription factor MYB39 | ||||
TrEMBL | A0A3P6BN33 | 4e-55 | A0A3P6BN33_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DWY7 | 4e-55 | M4DWY7_BRARP; Uncharacterized protein | ||||
STRING | Bra021033.1-P | 6e-56 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17785.1 | 2e-57 | myb domain protein 39 |