PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00177.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 114aa MW: 13002.9 Da PI: 8.0506 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.4 | 2.4e-54 | 4 | 99 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+ +lGf+dy+e+lk+yl++ Rsa1.0_00177.1_g00002.1 4 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMENLGFDDYAEQLKKYLNR 91 89************************************************************************************** PP NF-YB 90 yrelegek 97 yr +ege+ Rsa1.0_00177.1_g00002.1 92 YRVIEGER 99 *****997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-52 | 2 | 106 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-40 | 6 | 107 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-28 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-19 | 37 | 55 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 40 | 56 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-19 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 1.4E-19 | 75 | 93 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MMIKEQDRLL PIANVGRIMK NILPPNAKIS KEAKETMQEC VSEFISFVTG EASDKCHKEK 60 RKTVNGDDIC WAMENLGFDD YAEQLKKYLN RYRVIEGERV NQHGKGGPKS SPDN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-45 | 3 | 93 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-45 | 3 | 93 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00177.1_g00002.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787665 | 1e-139 | KC787665.1 Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018474925.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 4e-76 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A3P6BEM3 | 5e-75 | A0A3P6BEM3_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g002290.1 | 2e-75 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-78 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|