PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00166.1_g00016.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 227aa MW: 26652.8 Da PI: 9.8471 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.9 | 6.6e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g+lKKA+ELSvLCda+va ++fs++gklyey+s Rsa1.0_00166.1_g00016.1 9 KRIENLTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAVVFSQKGKLYEYAS 59 79***********************************************86 PP | |||||||
2 | K-box | 49.7 | 1.6e-17 | 83 | 173 | 9 | 96 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeen 91 ++e++ + l++e++ + + ie Lqr R+l+G+dL+s+sl+eL+++ q+eksl+ +Rs+K l e++++l+ ++el +e Rsa1.0_00166.1_g00016.1 83 QKEQQVQDLKNEITIMVNSIELLQRHCRRLMGQDLDSCSLEELKEITIQIEKSLTIVRSRKATLNEEEVRKLKAEiagKRELLNER 168 68999*****************************************************************9997522245555555 PP K-box 92 kaLrk 96 ++L++ Rsa1.0_00166.1_g00016.1 169 TRLHQ 173 55655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.413 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.01E-30 | 3 | 71 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.83E-38 | 3 | 68 | No hit | No description |
Pfam | PF00319 | 2.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.1E-17 | 84 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11 | 88 | 184 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MVRGKIEIKR IENLTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAVVFSQ KGKLYEYASS 60 DMKKMMERCE IHRREYFHAE RFQKEQQVQD LKNEITIMVN SIELLQRHCR RLMGQDLDSC 120 SLEELKEITI QIEKSLTIVR SRKATLNEEE VRKLKAEIAG KRELLNERTR LHQMETKLLS 180 FQFEEKPLWT QSRNLESEKN ASSSASENMH ISNVETDLFI GLPRSRV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-19 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 6e-19 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 6e-19 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 6e-19 | 1 | 66 | 1 | 66 | MEF2C |
6byy_A | 5e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_B | 5e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_C | 5e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_D | 5e-19 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00166.1_g00016.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232542 | 8e-80 | AC232542.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH005L20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018437428.1 | 1e-156 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_018437429.1 | 1e-156 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_018437430.1 | 1e-156 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_018437431.1 | 1e-156 | PREDICTED: MADS-box protein AGL71-like | ||||
Swissprot | Q9FLH5 | 7e-74 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A078HZW3 | 1e-140 | A0A078HZW3_BRANA; BnaAnng06990D protein | ||||
TrEMBL | A0A398AGB5 | 1e-140 | A0A398AGB5_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6B971 | 1e-140 | A0A3P6B971_BRACM; Uncharacterized protein | ||||
STRING | Bo2g161560.1 | 1e-136 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 9e-75 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|