PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00071.1_g00054.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 115aa MW: 12809.5 Da PI: 10.9911 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.3 | 2e-09 | 5 | 34 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +++WT+eE+ l+ +v ++G+ W+tI + Rsa1.0_00071.1_g00054.1 5 KQKWTPEEEAALKAGVLKHGTSKWRTILSD 34 79*************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.326 | 1 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.85E-11 | 2 | 51 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-6 | 5 | 33 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-11 | 5 | 51 | IPR009057 | Homeodomain-like |
CDD | cd11660 | 6.90E-13 | 6 | 50 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MGTPKQKWTP EEEAALKAGV LKHGTSKWRT ILSDPHFTSL LNSRSNVDLK KAKLALKRAL 60 PPPKHDHDGN NNNNNTRALT IVPLANEEER TNPTSPRTHA SKKSITRYKV HANSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00071.1_g00054.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189526 | 1e-46 | AC189526.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB092J12, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009112207.1 | 2e-49 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Refseq | XP_009112208.1 | 2e-49 | PREDICTED: telomere repeat-binding factor 2-like | ||||
Swissprot | Q9FJW5 | 1e-31 | TRB2_ARATH; Telomere repeat-binding factor 2 | ||||
TrEMBL | A0A397Y1Y8 | 5e-48 | A0A397Y1Y8_BRACM; Uncharacterized protein | ||||
TrEMBL | M4F9S6 | 5e-48 | M4F9S6_BRARP; Uncharacterized protein | ||||
STRING | Bra037839.1-P | 8e-49 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16580 | 8 | 12 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67580.2 | 3e-25 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|