PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00071.1_g00029.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 166aa MW: 18712.6 Da PI: 7.2712 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 85.7 | 4.3e-27 | 74 | 132 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk++ + r+YY+C+s+gC+vkk+ver+ +d +v++tYe+ Hnhe Rsa1.0_00071.1_g00029.1 74 MDDGYKWRKYGKKSVKNNINKRNYYKCSSEGCMVKKRVERDGKDAAYVITTYEEVHNHE 132 69********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.3E-30 | 61 | 134 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.23E-26 | 66 | 134 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.736 | 69 | 134 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.9E-29 | 74 | 133 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-21 | 75 | 132 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MFDDDEGGNT GLVQEETSPP ASIVSSETLT GESRGSGRAL TTLSKKESTG SKDGETKEPG 60 HRVAFRTRSK IDVMDDGYKW RKYGKKSVKN NINKRNYYKC SSEGCMVKKR VERDGKDAAY 120 VITTYEEVHN HEIPSHVYYN DMVSSHDHDN WNQHSLLQSI HISPPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-23 | 64 | 135 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-23 | 64 | 135 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00071.1_g00029.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493813 | 1e-119 | AB493813.1 Arabidopsis thaliana At5g64810 mRNA for hypothetical protein, partial cds, clone: RAAt5g64810. | |||
GenBank | AF426252 | 1e-119 | AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds. | |||
GenBank | BT025755 | 1e-119 | BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018452360.1 | 1e-118 | PREDICTED: probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 3e-88 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A0D3E293 | 1e-104 | A0A0D3E293_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6DZX3 | 1e-104 | A0A3P6DZX3_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g018440.1 | 1e-104 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5711 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-90 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|