PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_00053.1_g00015.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB

Protein Properties

Length: 230aa MW: 26104.8 Da PI: 10.1695

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_00053.1_g00015.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.9	6.2e-10	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ ++G ++W +I++ ++++kqck rw+ +l Rsa1.0_00053.1_g00015.1 8 GVWKNTEDEILKASMMKYGRNQWGRISSLAV-RKSAKQCKARWNEWL 53 78***************************.**********986 PP
2	Myb_DNA-binding	37.2	7e-12	60	103	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k l++ W+tIa +g Rt+ qc +r+ k+l Rsa1.0_00053.1_g00015.1 60 TEWTVEEDEKLLHLAKILPTQ-WRTIAPAVG--RTPSQCLERYEKLL 103 68***************99.****8..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.787	1	53	IPR017930	Myb domain
SMART	SM00717	7.9E-11	6	55	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.6E-17	9	61	IPR009057	Homeodomain-like
Pfam	PF13921	3.7E-12	10	70	No hit	No description
CDD	cd00167	1.33E-8	10	53	No hit	No description
SuperFamily	SSF46689	1.72E-20	33	105	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.773	54	107	IPR017930	Myb domain
CDD	cd11659	2.01E-30	55	106	No hit	No description
SMART	SM00717	1.6E-12	58	105	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.4E-14	62	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 230 aa Download sequence Send to blast
MRGMVKGGVW KNTEDEILKA SMMKYGRNQW GRISSLAVRK SAKQCKARWN EWLDPSIKKT 60 EWTVEEDEKL LHLAKILPTQ WRTIAPAVGR TPSQCLERYE KLLDAACGKG YEAGGDPRKL 120 GPGEIDPNPE SKPARPDAVD MEDYEMEMLS EARARFANTR GKKAKRRARE KQIQEARSLA 180 SLQKRRELRA AGIDDGKHRN KSKGKGIDYG AEIPFEKRAP AGFYDTADER

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
5xjc_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
5yzg_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
5z56_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
5z57_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
5z58_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6ff4_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6ff7_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6icz_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6id0_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6id1_L	1e-105	2	229	3	230	Cell division cycle 5-like protein
6qdv_O	1e-105	2	229	3	230	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_00053.1_g00015.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018454183.1	1e-169	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-124	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A078IAN9	1e-144	A0A078IAN9_BRANA; BnaC09g14760D protein
TrEMBL	A0A3N6RCJ4	1e-144	A0A3N6RCJ4_BRACR; Uncharacterized protein
TrEMBL	A0A3P6DQH6	1e-144	A0A3P6DQH6_BRAOL; Uncharacterized protein
STRING	Bo9g044140.1	1e-144	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-124	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]