PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC8781_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 227aa MW: 25828.3 Da PI: 8.9178 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.7 | 8.5e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +lv +++++G g+W+t +++ g+ R +k+c++rw++yl RrC8781_p1 14 KGEWTSEEDRILVAYINEYGLGDWRTLPKRAGLQRYGKSCRLRWLNYL 61 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.7 | 2.2e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E++ +++ + +lG++ W++Ia+ m+ +Rt++++k++w++ RrC8781_p1 67 RGKFTPQEEDDIIRFHSLLGNR-WAAIAKQMP-NRTDNDIKNHWNSC 111 89********************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.199 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.95E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.9E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.75E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.266 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.70E-10 | 69 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-25 | 69 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MGRTTWLDDD GLKKGEWTSE EDRILVAYIN EYGLGDWRTL PKRAGLQRYG KSCRLRWLNY 60 LRPGIKRGKF TPQEEDDIIR FHSLLGNRWA AIAKQMPNRT DNDIKNHWNS CLKKRLVRRG 120 IDPMTHEPVV KATSSSTMLS PTLTPSSCSS SFSSTSSARL LNRLAAGISS RKHGLDRIKN 180 VILSKPRQAV EEDKLMISSN EEEEEVTGCF MEIDDNLIST TSLDELL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738285 | 0.0 | KF738285.1 Brassica napus MYB transcription factor 95 (MYB95.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018445390.1 | 1e-165 | PREDICTED: transcription factor MYB34-like | ||||
Swissprot | Q9LE63 | 6e-60 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | A0A397YNY7 | 1e-126 | A0A397YNY7_BRACM; Uncharacterized protein | ||||
STRING | Bra003801.1-P | 1e-126 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74430.1 | 1e-104 | myb domain protein 95 |