PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC799_p5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 181aa MW: 20996.8 Da PI: 9.5994 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173.1 | 8.5e-54 | 17 | 146 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 +ppGfrFhPt+eel+ +yLkkkv+ ++++l +vi+evd++k+ePwdL++ ++ + ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ +++ RrC799_p5 17 VPPGFRFHPTEEELLYYYLKKKVSYEPIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSIHLNSS 115 69****************************.9***************952444443456***************************************** PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +++gl+ktLvfy+grap+g+kt+W+mheyrl RrC799_p5 116 KKIGLRKTLVFYTGRAPHGQKTEWIMHEYRL 146 *****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.27E-55 | 9 | 151 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.067 | 17 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.5E-28 | 18 | 146 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MEIGSSSTVA GGGQLSVPPG FRFHPTEEEL LYYYLKKKVS YEPIDLDVIR EVDLNKLEPW 60 DLKEKCRIGS GPQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKSI HLNSSKKIGL 120 RKTLVFYTGR APHGQKTEWI MHEYRLDDNE NEIQYAECSR RRTISEDFTK NKIKTIIITN 180 T |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 8e-47 | 13 | 146 | 11 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189312 | 1e-115 | AC189312.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034L08, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013592210.1 | 1e-113 | PREDICTED: protein SOMBRERO-like | ||||
Refseq | XP_013650288.1 | 1e-113 | protein SOMBRERO | ||||
Refseq | XP_013726972.1 | 1e-113 | protein SOMBRERO | ||||
Swissprot | Q9MA17 | 1e-112 | SMB_ARATH; Protein SOMBRERO | ||||
TrEMBL | A0A0D3D1V4 | 1e-111 | A0A0D3D1V4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3N6S8B8 | 1e-112 | A0A3N6S8B8_BRACR; Uncharacterized protein | ||||
TrEMBL | A0A3P6G287 | 1e-111 | A0A3P6G287_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g123980.1 | 1e-112 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6653 | 25 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79580.3 | 1e-89 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|