PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC7473_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 258aa MW: 29274.5 Da PI: 6.8462 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.5 | 1.7e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WTteEd++l++ + G +W++ ++ g++R++k+c++rw +yl RrC7473_p1 14 RGPWTTEEDKKLINFILTNGHYCWRALPNLAGLRRCGKSCRLRWTNYL 61 89******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 50.2 | 6e-16 | 71 | 111 | 5 | 47 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + +E++l +d+++ +G++ W++Ia++++ gRt++++k++w+++ RrC7473_p1 71 SHDEEQLVIDLHAHMGNK-WSKIASRLP-GRTDNEIKNHWNTH 111 789***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.19 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.78E-26 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.6E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.9E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.74E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.14 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-25 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.22E-11 | 71 | 112 | No hit | No description |
Pfam | PF00249 | 2.5E-14 | 71 | 111 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
MGRQPCCDKL GVKRGPWTTE EDKKLINFIL TNGHYCWRAL PNLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL SHDEEQLVID LHAHMGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLVKMG 120 IDPVTHQPLN QEPNNTDDNS MEPKSSSTKN VETNGITKEN ESSSTVTGQN SSMDSESHLL 180 SNIYNDEQLF SYLWSDESTK AETAWSDGNY DIGGTLYHDS NISGGGADFP IWSPQINKGK 240 NWTFQDSCQD FGVHDFGF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-25 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175993 | 1e-128 | AF175993.2 Arabidopsis thaliana putative transcription factor (MYB85) mRNA, complete cds. | |||
GenBank | AK175718 | 1e-128 | AK175718.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-25-P15. | |||
GenBank | AK175777 | 1e-128 | AK175777.1 Arabidopsis thaliana mRNA for myb-like protein, complete cds, clone: RAFL22-35-I17. | |||
GenBank | AY085497 | 1e-128 | AY085497.1 Arabidopsis thaliana clone 154343 mRNA, complete sequence. | |||
GenBank | AY519608 | 1e-128 | AY519608.1 Arabidopsis thaliana MYB transcription factor (At4g22680) mRNA, complete cds. | |||
GenBank | DQ446863 | 1e-128 | DQ446863.1 Arabidopsis thaliana clone pENTR221-At4g22680 myb family transcription factor (At4g22680) mRNA, complete cds. | |||
GenBank | DQ653218 | 1e-128 | DQ653218.1 Arabidopsis thaliana clone 0000012874_0000009286 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018448942.1 | 0.0 | PREDICTED: protein ODORANT1-like | ||||
Swissprot | Q50EX6 | 1e-85 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A3P6C7S3 | 1e-161 | A0A3P6C7S3_BRACM; Uncharacterized protein | ||||
STRING | Bo3g165540.1 | 1e-160 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22680.1 | 1e-145 | myb domain protein 85 |
Publications ? help Back to Top | |||
---|---|---|---|
|