PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC710_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 341aa    MW: 37990.4 Da    PI: 7.2132
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC710_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.51e-061052440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               + C+++ +   + +C+ ++ +lC +C  ++H        H++v
  RrC710_p2 10 QACDTCRSAACTVYCRADSAYLCTSCDAQIHAAnrlasrHERV 52
               57******99*********************656788888876 PP

2zf-B_box35.71.8e-115297342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                r+C+ +e+ ++ +fC+ +   lC  C +++H+       H++vp+
  RrC710_p2 52 VRVCQSCERAPAAFFCKADAASLCTACDSQIHSAnplarrHQRVPI 97
               689*****************************66899999**9997 PP

3CCT67.43.9e-23274318145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                R+a+++RY+eK+ktRkFeK+irY+sRK++Ae+RpR+KGrF+k++e
  RrC710_p2 274 RKARVMRYREKKKTRKFEKTIRYASRKEYAEKRPRIKGRFAKRNE 318
                9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.765754IPR000315B-box-type zinc finger
SMARTSM003369.3E-9754IPR000315B-box-type zinc finger
CDDcd000219.84E-81254No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006434.2E-95297IPR000315B-box-type zinc finger
CDDcd000215.33E-105397No hitNo description
SMARTSM003361.9E-125597IPR000315B-box-type zinc finger
PfamPF062032.4E-17274316IPR010402CCT domain
PROSITE profilePS5101716.648274316IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MLKQESNWAQ ACDTCRSAAC TVYCRADSAY LCTSCDAQIH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS QIHSANPLAR RHQRVPILPI SGSMATNHSS ETTEPENIVV  120
VGQEEEDEAE AASWLLPSSV KNCGDNNNNN NRFSVGEEYL DLVDYSSSMD KRFIGQSNQY  180
QQDYNVPQRS YVADGVVPLQ LDVSKGHTHH EQHNFQFGFT NVSSEAYGSS SGSPIHMVSL  240
VPESTTTSEA TVSPKAATEE LPDAPVQMLS PMERKARVMR YREKKKTRKF EKTIRYASRK  300
EYAEKRPRIK GRFAKRNEVD ANQGLSTMVM FDTGYGIVPS F
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5104490.0AF510449.1 Brassica nigra isolate S178GE COL1 protein (COL1) gene, complete cds.
GenBankAF5104520.0AF510452.1 Brassica nigra isolate S53SM COL1 protein (COL1) gene, complete cds.
GenBankAF5104530.0AF510453.1 Brassica nigra isolate 27SPA COL1 protein (COL1) gene, complete cds.
GenBankAF5104550.0AF510455.1 Brassica nigra isolate 24SPA COL1 protein (COL1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018443082.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1
SwissprotO500551e-164COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLQ8GRR60.0Q8GRR6_BRANI; COL1 protein
STRINGBra008668.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-140CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]