PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC6642_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 126aa MW: 14603.5 Da PI: 9.0471 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.4 | 2.9e-09 | 82 | 115 | 21 | 54 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 k +yp++ ++ LA+ +gL+++q+ +WF N+R + RrC6642_p1 82 KWPYPTEGDKIALADATGLDQKQINNWFINQRKR 115 569*****************************88 PP | |||||||
2 | ELK | 27 | 1e-09 | 36 | 57 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrK+++ ++sLk EFs RrC6642_p1 36 DLKDRLLRKFGSGISSLKLEFS 57 69*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 5.6E-6 | 36 | 57 | IPR005539 | ELK domain |
SMART | SM01188 | 2.5E-4 | 36 | 57 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.202 | 36 | 56 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.179 | 56 | 119 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.56E-19 | 57 | 124 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.0E-12 | 58 | 123 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-27 | 61 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.65E-10 | 65 | 120 | No hit | No description |
Pfam | PF05920 | 6.3E-18 | 76 | 115 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MTILRVPEDG AVSSDEELSG GDEILQDGKQ ICEDRDLKDR LLRKFGSGIS SLKLEFSKKK 60 KKGKLPREAR QALLDWWSVH YKWPYPTEGD KIALADATGL DQKQINNWFI NQRKRHWNQS 120 ENMPYA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018466427.1 | 3e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 6e-68 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A397YFC1 | 4e-80 | A0A397YFC1_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DIM1 | 4e-80 | M4DIM1_BRARP; Uncharacterized protein | ||||
STRING | Bra016348.1-P | 7e-81 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-62 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|