PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC61838_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 99aa MW: 10244.7 Da PI: 11.2916 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 125.4 | 6e-39 | 22 | 92 | 3 | 73 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 + k++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++tieWLlqqa+pai++ tgt++++a+++ RrC61838_p1 22 AVKKPSKDRHTKVDGRGRRIRMPAVCAARVFQLTRELGHKSDGETIEWLLQQAEPAIIATTGTGTIPANFS 92 56899***************************************************************887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 27.489 | 27 | 81 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 1.8E-34 | 27 | 99 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
PGGGGGGGGS VPSTALAVVK PAVKKPSKDR HTKVDGRGRR IRMPAVCAAR VFQLTRELGH 60 KSDGETIEWL LQQAEPAIIA TTGTGTIPAN FSTLNASLR |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00228 | DAP | Transfer from AT1G72010 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018457249.1 | 2e-62 | PREDICTED: transcription factor TCP22-like | ||||
Swissprot | Q9C7G4 | 1e-51 | TCP22_ARATH; Transcription factor TCP22 | ||||
TrEMBL | A0A3P6B6Q2 | 8e-57 | A0A3P6B6Q2_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DHW3 | 8e-57 | M4DHW3_BRARP; Uncharacterized protein | ||||
STRING | Bra016090.1-P | 1e-57 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7053 | 24 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72010.1 | 2e-35 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|