PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC4716_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 126aa MW: 13700.4 Da PI: 9.9076 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 121.1 | 4e-38 | 24 | 84 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++l+cprC+stntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGg +rk+ k+s RrC4716_p1 24 QQDQLPCPRCESTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGVSRKSSKRS 84 57889***************************************************98875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-30 | 2 | 76 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.0E-33 | 26 | 82 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.584 | 28 | 82 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 30 | 66 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MPSDLNESRR LTTKMPHGGA VGDQQDQLPC PRCESTNTKF CYYNNYNFSQ PRHFCKACRR 60 YWTHGGTLRD IPVGGVSRKS SKRSRTCSSS VAVSTAAVGS REFPLQATPV LFPPSSNDGG 120 VAAAKG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018434422.1 | 3e-85 | PREDICTED: dof zinc finger protein DOF5.8 | ||||
Swissprot | Q9FGD6 | 2e-65 | DOF58_ARATH; Dof zinc finger protein DOF5.8 | ||||
TrEMBL | A0A078FEI8 | 8e-76 | A0A078FEI8_BRANA; BnaC07g16430D protein | ||||
TrEMBL | A0A0D3D8A9 | 8e-76 | A0A0D3D8A9_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6EJ53 | 8e-76 | A0A3P6EJ53_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g064260.1 | 1e-76 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2286 | 28 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66940.1 | 6e-53 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|