PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC387_p6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 148aa MW: 16914.7 Da PI: 10.5883 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.4 | 1.1e-33 | 9 | 65 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQyq+Il+RRq+Rak+e e kl +ksrkpylheSRh+hA+rRpRg+gGrF RrC387_p6 9 QEPVYVNAKQYQAILRRRQARAKAELEMKL-IKSRKPYLHESRHQHAMRRPRGTGGRF 65 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.2E-36 | 7 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.414 | 8 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.9E-29 | 10 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.5E-24 | 11 | 33 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 13 | 33 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.5E-24 | 42 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MPLPPEVAQE PVYVNAKQYQ AILRRRQARA KAELEMKLIK SRKPYLHESR HQHAMRRPRG 60 TGGRFAKKTN TEASQPKARE KSNGSRTQSP TSSHSDQPEA WNDEYRTQSE EMQSSASNRR 120 EEAEDCSGQQ WNSISSSNHP SQARLAIK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-20 | 9 | 65 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF412056 | 1e-113 | AF412056.1 Arabidopsis thaliana AT3g20910/MFD22_2 mRNA, complete cds. | |||
GenBank | AY087696 | 1e-113 | AY087696.1 Arabidopsis thaliana clone 37744 mRNA, complete sequence. | |||
GenBank | AY093971 | 1e-113 | AY093971.1 Arabidopsis thaliana AT3g20910/MFD22_2 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018491805.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit A-9 isoform X1 | ||||
Refseq | XP_018491806.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit A-9 isoform X2 | ||||
Refseq | XP_018491807.1 | 1e-100 | PREDICTED: nuclear transcription factor Y subunit A-9 isoform X3 | ||||
Swissprot | Q945M9 | 9e-82 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
TrEMBL | A0A397ZC38 | 5e-88 | A0A397ZC38_BRACM; Uncharacterized protein | ||||
STRING | Bra031242.1-P | 5e-88 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13268 | 18 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 4e-84 | nuclear factor Y, subunit A9 |
Publications ? help Back to Top | |||
---|---|---|---|
|