PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2885_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 153aa MW: 18428 Da PI: 10.2005 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.3 | 1.8e-18 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l ++++ +G g+W++ +r+ g+ Rt+k+c++rw++yl RrC2885_p1 21 RGPWTAEEDFKLMNYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.2 | 1.4e-16 | 74 | 117 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ RrC2885_p1 74 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.363 | 16 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.71E-32 | 17 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.9E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-16 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-23 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.60E-10 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 22.917 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-14 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-15 | 74 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-23 | 76 | 122 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.10E-6 | 94 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MDEKGRNLNN NNMEDEMDLK RGPWTAEEDF KLMNYIATHG EGRWNSLSRC AGLQRTGKSC 60 RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ 120 KHAKQLKCDV NSQQFKDTMK YLWMPRLVER IQS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-26 | 18 | 121 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738287 | 0.0 | KF738287.1 Brassica napus MYB transcription factor 108-2 (MYB108-2.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013751922.1 | 1e-112 | transcription factor MYB108-like | ||||
Refseq | XP_018489043.1 | 1e-111 | PREDICTED: transcription factor MYB108-like | ||||
Swissprot | Q9LDE1 | 1e-110 | MY108_ARATH; Transcription factor MYB108 | ||||
TrEMBL | A0A0D3CMB3 | 1e-109 | A0A0D3CMB3_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g143460.1 | 1e-110 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06490.1 | 1e-91 | myb domain protein 108 |
Publications ? help Back to Top | |||
---|---|---|---|
|