PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC26324_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 89aa MW: 10104.7 Da PI: 11.3323 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 128.3 | 2.2e-40 | 14 | 74 | 3 | 63 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s+s RrC26324_p1 14 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSKS 74 6789*****************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-32 | 1 | 66 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.2E-33 | 15 | 71 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.469 | 17 | 71 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 19 | 55 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MVERARIAKI PLPEAALKCP RCDSTNTKFC YFNNYNLTQP RHFCKTCRRY WTRGGALRNV 60 PVGGGFRRNK RSKSNGGGRS KSTVVLLEP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018477452.1 | 6e-57 | PREDICTED: dof zinc finger protein DOF3.6-like | ||||
Refseq | XP_022566925.1 | 5e-57 | dof zinc finger protein DOF3.6-like isoform X1 | ||||
Swissprot | Q9M2U1 | 3e-50 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
TrEMBL | A0A078JRU0 | 8e-56 | A0A078JRU0_BRANA; BnaCnng62100D protein | ||||
TrEMBL | A0A0D3BXR7 | 1e-55 | A0A0D3BXR7_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g116790.1 | 2e-56 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1713 | 28 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G55370.2 | 7e-46 | OBF-binding protein 3 |