PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2292_p7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 224aa MW: 24912.8 Da PI: 6.7909 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 172.6 | 4.2e-54 | 51 | 145 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg RrC2292_p7 51 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFVTGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEG 145 69*******************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-49 | 47 | 149 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.22E-37 | 54 | 156 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.8E-25 | 57 | 121 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.9E-17 | 85 | 103 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 88 | 104 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.9E-17 | 104 | 122 | No hit | No description |
PRINTS | PR00615 | 7.9E-17 | 123 | 141 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MERGGFHGYG KLNTTNNPAK FLMAESSSMQ LSELNHPNKT ANGVGEEECT VREQDRFMPI 60 ANVIRIMRRI LPAHAKISDD SKETIQECVS EYISFVTGEA NERCQREQRK TITAEDVLWA 120 MSKLGFDDYI EPLTLYLHRY RELEGGDRGG VSYNAGGSVS MTNGMVVKRT NGIEYGAYGG 180 TMPGIHMAYR HQNGFVYNGN EPNSRMGGGS SSASSVFPTQ QQKY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-65 | 50 | 142 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU371727 | 1e-146 | EU371727.1 Brassica napus leafy cotyledon 1-like protein (L1L) gene, complete cds. | |||
GenBank | KC787667 | 1e-146 | KC787667.1 Brassica napus transcription factor subunit NF-YB6B (NF-YB6B) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018456756.1 | 1e-157 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Refseq | XP_018456757.1 | 1e-157 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Refseq | XP_018456758.1 | 1e-157 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Refseq | XP_018456759.1 | 1e-157 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 1e-118 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A078FT61 | 1e-120 | A0A078FT61_BRANA; BnaA06g35340D protein | ||||
TrEMBL | A0A397Z814 | 1e-120 | A0A397Z814_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E818 | 1e-120 | M4E818_BRARP; Uncharacterized protein | ||||
STRING | Bra024924.1-P | 1e-121 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9896 | 26 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 1e-119 | nuclear factor Y, subunit B6 |