PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2196_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 179aa MW: 19410.8 Da PI: 9.7154 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.3 | 7.2e-56 | 31 | 125 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvyl++yre ++ RrC2196_p2 31 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLTRYREGDT 125 69*****************************************************************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.8E-53 | 27 | 149 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.86E-39 | 34 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-27 | 37 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-20 | 65 | 83 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-20 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 1.3E-20 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MAESQQQAKS PGGGGGGESG GDQSPRSSSH VREQDRFLPI ANISRIMKRG LPANGKIAKD 60 AKEIVQECVS EFISFITSEA SDKCQREKRK TINGDDLLWA MATLGFEDYI DPLKVYLTRY 120 REGDTKGSAK GGDANAKKDV QSSQNGQSDK SRSLFLPSGS SRSLLTKALS HKLLTETLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-47 | 31 | 122 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-47 | 31 | 122 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353083 | 1e-115 | AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133115.1 | 4e-94 | PREDICTED: nuclear transcription factor Y subunit B-8 | ||||
Refseq | XP_013738285.1 | 4e-94 | nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q8VYK4 | 4e-90 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0D3B5C3 | 2e-93 | A0A0D3B5C3_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g031490.1 | 4e-94 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 2e-81 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|