PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC21148_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 153aa MW: 17356 Da PI: 10.1252 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 133.5 | 1.4e-41 | 5 | 135 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lp+GfrF Pt+ el+++yL+ ++ g + ++ + i+ +d+++veP +Lp+ ++++++++w fF++r++++a+g r++r+t+sgyWkatg+ +v+s RrC21148_p1 5 LPVGFRFYPTEVELISFYLRIQLGGGHATIYSLIPIIDVFNVEPTQLPNlageRCRGDKEQWLFFVPRQEREARGGRPSRTTNSGYWKATGSPGPVFS 102 79****************************999**************9656766667888************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyr 127 +++++g+kkt+vfy g+apkg+kt+W m+ey+ RrC21148_p1 103 PDNRVIGVKKTMVFYIGKAPKGRKTKWKMNEYK 135 ********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-43 | 3 | 141 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 43.236 | 5 | 153 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-20 | 6 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MVEELPVGFR FYPTEVELIS FYLRIQLGGG HATIYSLIPI IDVFNVEPTQ LPNLAGERCR 60 GDKEQWLFFV PRQEREARGG RPSRTTNSGY WKATGSPGPV FSPDNRVIGV KKTMVFYIGK 120 APKGRKTKWK MNEYKAIDET ASVSTIPKVH NHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-32 | 5 | 138 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-32 | 5 | 138 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-32 | 5 | 138 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-32 | 5 | 138 | 17 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swm_B | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swm_C | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swm_D | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swp_A | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swp_B | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swp_C | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
3swp_D | 1e-32 | 5 | 138 | 20 | 147 | NAC domain-containing protein 19 |
4dul_A | 1e-32 | 5 | 138 | 17 | 144 | NAC domain-containing protein 19 |
4dul_B | 1e-32 | 5 | 138 | 17 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018491634.1 | 1e-106 | PREDICTED: putative NAC domain-containing protein 61 | ||||
Swissprot | Q9M290 | 9e-95 | NAC61_ARATH; Putative NAC domain-containing protein 61 | ||||
TrEMBL | A0A0D3BGX4 | 1e-103 | A0A0D3BGX4_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g123480.1 | 1e-104 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1445 | 28 | 93 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44350.1 | 4e-97 | NAC domain containing protein 61 |