PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

RrC20871_p1

Organism

Raphanus raphanistrum

Taxonomic ID

109996

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 88aa MW: 10153.7 Da PI: 9.4355

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC20871_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.2	1.9e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l++ ++ +G g+W+++++ g+ R++k+c++rw +yl RrC20871_p1 14 KGLWSPEEDEKLLNHITTHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.2E-28	6	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.81	9	65	IPR017930	Myb domain
SMART	SM00717	1.6E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.28E-22	16	88	IPR009057	Homeodomain-like
CDD	cd00167	5.39E-11	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.1E-9	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.115	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT THGHGCWSSV PKLAGLQRCG KSCRLRWINY 60 LRPDLKRGAF SPEEENLIVE LHAVLGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-15	11	88	24	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269\|PubMed:16005292, ECO:0000269\|PubMed:19401413, ECO:0000269\|PubMed:22708996, ECO:0000269\|PubMed:23741471, ECO:0000269\|PubMed:28207974}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY063939	1e-104	AY063939.1 Arabidopsis thaliana putative transcription factor (At1g09540) mRNA, complete cds.
GenBank	AY096523	1e-104	AY096523.1 Arabidopsis thaliana putative transcription factor protein (At1g09540) mRNA, complete cds.
GenBank	AY519552	1e-104	AY519552.1 Arabidopsis thaliana MYB transcription factor (At1g09540) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009148252.1	2e-61	PREDICTED: transcription repressor MYB6-like
Refseq	XP_010490115.1	2e-61	PREDICTED: transcription repressor MYB6-like
Swissprot	Q8VZQ2	4e-59	MYB61_ARATH; Transcription factor MYB61
TrEMBL	A0A1J3D5Q3	1e-59	A0A1J3D5Q3_NOCCA; Transcription factor MYB86
TrEMBL	M4DU23	4e-60	M4DU23_BRARP; Uncharacterized protein
STRING	Bra020016.1-P	7e-61	(Brassica rapa)
STRING	Bostr.25494s0012.1.p	8e-61	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09540.1	2e-61	myb domain protein 61

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Matías-Hernández L, et al. AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana. Plant J., 2017. 90(3): p. 520-534 [PMID:28207974]