PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC19533_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 167aa MW: 19540.2 Da PI: 9.9383 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.2 | 1.5e-53 | 16 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 l pGfrFhPtdeelv++yLk+k+++++l++ e i+++diyk++PwdLp k++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+ ++ RrC19533_p1 16 LLPGFRFHPTDEELVSFYLKRKIQHNPLSI-ELIRQLDIYKYDPWDLP-KFATGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSeGN 111 579***************************.89***************.777899***************************************9566 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + +glkk+Lvfykgra kg+ktdW+mhe+r+ RrC19533_p1 112 KCIGLKKSLVFYKGRAAKGVKTDWMMHEFRM 142 67***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.32E-56 | 12 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.995 | 16 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-26 | 18 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MGERNNDGDQ KMEEVLLPGF RFHPTDEELV SFYLKRKIQH NPLSIELIRQ LDIYKYDPWD 60 LPKFATGEKE WYFYCPRDRK YRNSSRPNRV TGAGFWKATG TDRPIYSSEG NKCIGLKKSL 120 VFYKGRAAKG VKTDWMMHEF RMPSLSEPSP SSKRFFDSPV SPNVSSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-51 | 1 | 153 | 4 | 153 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swm_B | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swm_C | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swm_D | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swp_A | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swp_B | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swp_C | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
3swp_D | 3e-51 | 1 | 153 | 7 | 156 | NAC domain-containing protein 19 |
4dul_A | 3e-51 | 1 | 153 | 4 | 153 | NAC domain-containing protein 19 |
4dul_B | 3e-51 | 1 | 153 | 4 | 153 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189385 | 1e-163 | AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018450269.1 | 1e-120 | PREDICTED: protein FEZ-like | ||||
Swissprot | Q9ZVH0 | 1e-108 | FEZ_ARATH; Protein FEZ | ||||
TrEMBL | A0A397YNI4 | 1e-117 | A0A397YNI4_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3N6R3Z2 | 1e-117 | A0A3N6R3Z2_BRACR; Uncharacterized protein | ||||
STRING | Bra016294.1-P | 1e-118 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26870.1 | 1e-110 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|