PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC18144_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 79aa    MW: 9303.94 Da    PI: 9.8889
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC18144_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.3e-111443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     +g+WT eEd++l+d+++++G g+W+t ++ 
      RrC18144_p1 14 KGPWTSEEDQKLLDYIQKHGYGNWRTLPKN 43
                     79************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-14543IPR009057Homeodomain-like
PROSITE profilePS500907.584942IPR017877Myb-like domain
SuperFamilySSF466891.17E-101145IPR009057Homeodomain-like
PfamPF002499.3E-91442IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDQKLLDYIQ KHGYGNWRTL PKNAVIKFCF LLNIRFTKMW  60
QELSVKVVCY CGAFAWKNR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0322984e-39KF032298.1 Leavenworthia alabamica pop-variant Russellville self-incompatibility gene locus, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108500.13e-28PREDICTED: myb-related protein 315-like
SwissprotQ9LDR81e-27MY102_ARATH; Transcription factor MYB102
TrEMBLA0A397YHZ98e-27A0A397YHZ9_BRACM; Uncharacterized protein
TrEMBLM4DWJ88e-27M4DWJ8_BRARP; Uncharacterized protein
STRINGBra020892.1-P1e-27(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2280633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.16e-30MYB-like 102
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  4. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]