PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC17478_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 182aa MW: 21095.7 Da PI: 7.9987 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.8e-16 | 24 | 66 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +++WT+ Ed++lv+a+k +G++ W++Ia ++ gRt++ +k+rw+ RrC17478_p1 24 KNAWTEKEDQILVEAHKAFGNK-WTKIALKLH-GRTENAIKNRWN 66 689*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.976 | 1 | 18 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.71E-24 | 1 | 73 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 8.4E-9 | 2 | 28 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.876 | 19 | 73 | IPR017930 | Myb domain |
SMART | SM00717 | 4.2E-15 | 23 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-15 | 24 | 66 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.52E-11 | 26 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.3E-18 | 29 | 67 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MLGTRIGKQC RERWHNHLRH GIKKNAWTEK EDQILVEAHK AFGNKWTKIA LKLHGRTENA 60 IKNRWNATKR RMHFMKMKQS DKNANPPQNV ILAGYIRHVT NKNESPNTKE TDCTKNDDYD 120 NAFDGEMDLS LGVTTQNTEP LASMSTTSCY VPEPATTFSW DDYITNVCES KDDFDMIMQG 180 WE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-25 | 2 | 71 | 37 | 106 | B-MYB |
1gv2_A | 4e-25 | 2 | 71 | 34 | 103 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-25 | 2 | 71 | 34 | 103 | C-Myb DNA-Binding Domain |
1msf_C | 3e-25 | 2 | 71 | 34 | 103 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of target genes (PubMed:27681170). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner (PubMed:18695688). Together with MYB118, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:27681170}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by LEC2 but repressed by MYB118. {ECO:0000269|PubMed:27681170}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018479665.1 | 1e-135 | PREDICTED: transcription factor MYB98 | ||||
Swissprot | Q1PDP9 | 9e-46 | MY115_ARATH; Transcription factor MYB115 | ||||
TrEMBL | A0A0D3C086 | 1e-112 | A0A0D3C086_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g140150.1 | 1e-112 | (Brassica oleracea) | ||||
STRING | Bo4g140330.1 | 1e-113 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13303 | 14 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40360.1 | 4e-48 | myb domain protein 115 |
Publications ? help Back to Top | |||
---|---|---|---|
|