PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC1543_p4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 216aa MW: 23944.4 Da PI: 10.1527 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 88.4 | 8.5e-28 | 86 | 148 | 1 | 63 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsateva 63 s+yk+kaal++++++p+f++l+sg++kl+++G+lll++a+a+++r+ydW++kq+f+ls+te++ RrC1543_p4 86 SIYKGKAALTIEPRAPEFVSLQSGAFKLSKEGFLLLQFAPAAGVRQYDWSRKQVFSLSVTEIG 148 7************************************************************98 PP | |||||||
2 | Whirly | 22.8 | 1.5e-07 | 149 | 177 | 111 | 139 |
Whirly 111 vtnslvkgnesfsvPvskaefavlrsllv 139 v+n+l++++es+++P++kaefavl+s+++ RrC1543_p4 149 VQNKLLNVDESVYIPITKAEFAVLISAFN 177 99************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 1.4E-31 | 75 | 148 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 4.47E-55 | 79 | 216 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 9.6E-25 | 87 | 148 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 2.9E-16 | 149 | 200 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MSQLLSSPPM AVNSRTFLTH RFPEARFLTA GGFVGKGHCF AVKVKPMEER VKLTLKSRYS 60 DSSSPPYSPP KNGEGGSSTR FYVGHSIYKG KAALTIEPRA PEFVSLQSGA FKLSKEGFLL 120 LQFAPAAGVR QYDWSRKQVF SLSVTEIGVQ NKLLNVDESV YIPITKAEFA VLISAFNFIL 180 PHLIGWQAFA NSIKPEDSNR LNNASPKYGG DYEWSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4koq_A | 2e-67 | 77 | 194 | 5 | 169 | Single-stranded DNA-binding protein WHY3, chloroplastic |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In the nucleus, is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:19669906}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK230205 | 1e-81 | AK230205.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-96-O15. | |||
GenBank | BT015336 | 1e-81 | BT015336.1 Arabidopsis thaliana At2g02740 gene, complete cds. | |||
GenBank | BT015641 | 1e-81 | BT015641.1 Arabidopsis thaliana At2g02740 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018483253.1 | 1e-137 | PREDICTED: single-stranded DNA-binding protein WHY3, chloroplastic isoform X1 | ||||
Refseq | XP_018483254.1 | 1e-137 | PREDICTED: single-stranded DNA-binding protein WHY3, chloroplastic isoform X2 | ||||
Swissprot | Q66GR6 | 1e-105 | WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic | ||||
TrEMBL | A0A3P6EY56 | 1e-123 | A0A3P6EY56_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g080560.1 | 1e-123 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5023 | 27 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02740.2 | 1e-105 | ssDNA-binding transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|