PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC1508_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 121aa MW: 13608.9 Da PI: 9.131 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 127.7 | 5.3e-40 | 5 | 105 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lrr+C+kdC+++pyfp ++p kfa++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq q++++++ la++++ RrC1508_p2 5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFACIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTQIQKTQTLLARTQA 103 6*********************************************************************************************99998 PP DUF260 100 el 101 ++ RrC1508_p2 104 QI 105 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.726 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFACIHRI YGAGNVSKML QQLPVQTRAE 60 AVESLSFEAK CRVEDPVYGC VGIISLLQTQ IQKTQTLLAR TQAQIAVAQA KHSQTQISEF 120 M |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-37 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-37 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473847 | 1e-116 | AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds. | |||
GenBank | DQ056609 | 1e-116 | DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018483059.1 | 6e-86 | PREDICTED: LOB domain-containing protein 23 | ||||
Swissprot | P59467 | 5e-75 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
TrEMBL | A0A078FKY4 | 2e-82 | A0A078FKY4_BRANA; BnaA06g32760D protein | ||||
TrEMBL | A0A291LR06 | 2e-82 | A0A291LR06_BRARR; Transcription factor LBD24 | ||||
TrEMBL | A0A397ZCU9 | 2e-82 | A0A397ZCU9_BRACM; Uncharacterized protein | ||||
STRING | Bo7g083780.1 | 2e-78 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 2e-66 | LOB domain-containing protein 23 |