PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC1214_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 140aa MW: 15419.7 Da PI: 8.4759 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163.8 | 2.4e-51 | 17 | 105 | 1 | 89 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 vreqdr+lPian+srimk++lP n+ki+kdak+tvqecvsefisfvtseasd+cq+ekrkt+ng+dllwa++tlGfedy+epl++yl++ RrC1214_p2 17 VREQDRYLPIANISRIMKRALPPNGKIGKDAKDTVQECVSEFISFVTSEASDRCQKEKRKTVNGEDLLWAMTTLGFEDYLEPLRLYLAR 105 69*************************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-48 | 15 | 105 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-36 | 20 | 105 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.8E-27 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.3E-18 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.3E-18 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 6.3E-18 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MADTPSSPGG GESGGSVREQ DRYLPIANIS RIMKRALPPN GKIGKDAKDT VQECVSEFIS 60 FVTSEASDRC QKEKRKTVNG EDLLWAMTTL GFEDYLEPLR LYLARGIIRA QERAGIVTIE 120 MQLGVVPVKI CRAGEARSFK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-46 | 16 | 105 | 2 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-46 | 16 | 105 | 2 | 91 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353248 | 1e-100 | AK353248.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-27-P17. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018458420.1 | 3e-72 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_018474671.1 | 3e-72 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q9SLG0 | 1e-67 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A384KRF5 | 9e-66 | A0A384KRF5_ARATH; NF-YB1 | ||||
TrEMBL | B6EUB6 | 9e-66 | B6EUB6_ARATH; Nuclear factor Y, subunit B1 | ||||
TrEMBL | E4MXK1 | 8e-66 | E4MXK1_EUTHA; mRNA, clone: RTFL01-27-P17 | ||||
TrEMBL | V4P018 | 8e-66 | V4P018_EUTSA; Uncharacterized protein | ||||
STRING | XP_006411113.1 | 1e-66 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 6e-61 | nuclear factor Y, subunit B1 |