PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC10347_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 143aa MW: 15372 Da PI: 10.4194 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124 | 4.7e-39 | 48 | 108 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++lkcprC s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+ RrC10347_p1 48 HHQSLKCPRCSSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 108 57899*****************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-33 | 39 | 106 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.7E-33 | 50 | 106 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.366 | 52 | 106 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 54 | 90 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MQDIHDYSMT GGGGSGGNTG RFYGGGIGGG GGGGDRRMRT HQNSILNHHQ SLKCPRCSSL 60 NTKFCYYNNY NLSQPRHFCK NCRRYWTKGG VLRNVPVGGG CRKAKRSKSK QPTSSSPSSA 120 DKPTTQNVEE KSSSSESSSL TAS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353138 | 1e-131 | AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018485182.1 | 2e-72 | PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF5.4 | ||||
Swissprot | Q8LDR0 | 4e-58 | DOF54_ARATH; Dof zinc finger protein DOF5.4 | ||||
TrEMBL | A0A398A6M0 | 2e-70 | A0A398A6M0_BRACM; Uncharacterized protein | ||||
TrEMBL | M4D943 | 3e-70 | M4D943_BRARP; Uncharacterized protein | ||||
STRING | Bra013003.1-P | 4e-71 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4482 | 26 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60850.1 | 2e-50 | OBF binding protein 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|