PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC10133_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | LFY | ||||||||
Protein Properties | Length: 114aa MW: 12515.4 Da PI: 7.5311 | ||||||||
Description | LFY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FLO_LFY | 137.7 | 1.4e-42 | 1 | 114 | 1 | 116 |
FLO_LFY 1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifr 98 mdpe f++ lf+w+p a++++p+ + + +++ +p++ +++a ++l +l lf yGvr++t+akiaelGft+stLv+mkdeel+d+ +sls+ifr RrC10133_p1 1 MDPEGFTSGLFRWNPTRAIVQAPTPVPQPQQQ--SPATPQTVAFGMRLGGLVGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMKNSLSHIFR 96 9*************877777777666555543..333457777888899************************************************* PP FLO_LFY 99 ldllvGeryGikaavrae 116 ++llvGeryGikaavrae RrC10133_p1 97 WELLVGERYGIKAAVRAE 114 *****************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF01698 | 1.0E-44 | 1 | 114 | IPR002910 | Floricaula/leafy protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MDPEGFTSGL FRWNPTRAIV QAPTPVPQPQ QQSPATPQTV AFGMRLGGLV GLFGPYGVRF 60 YTAAKIAELG FTASTLVGMK DEELEDMKNS LSHIFRWELL VGERYGIKAA VRAE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ude_A | 2e-20 | 46 | 114 | 8 | 76 | GINLFY PROTEIN |
4ude_B | 2e-20 | 46 | 114 | 8 | 76 | GINLFY PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls floral meristem identity. Is required very early in flower development and may act here as a transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | Z18362 | 1e-142 | Z18362.1 Brassica oleracea gene encoding BOFH. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013646985.1 | 2e-55 | putative transcription factor BOFH | ||||
Swissprot | Q05536 | 3e-55 | BOFH_BRAOB; Putative transcription factor BOFH | ||||
TrEMBL | A5YYH1 | 6e-55 | A5YYH1_ARATH; Leafy (Fragment) | ||||
TrEMBL | Q3ZLS6 | 6e-55 | Q3ZLS6_SELAU; LEAFY protein (Fragment) | ||||
STRING | Bra019619.1-P | 5e-54 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7907 | 28 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61850.1 | 4e-53 | floral meristem identity control protein LEAFY (LFY) |