PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 55072.m000012 | ||||||||
Common Name | RCOM_2112360 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 101aa MW: 11715.6 Da PI: 10.5986 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.8 | 1.2e-13 | 42 | 88 | 1 | 47 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 e e ++er+k+kNR +A rsR++K ++++ Leekv+eL +eN ++ 55072.m000012 42 EDEMRKERKKIKNRASAARSREKKVERTKFLEEKVEELREENAQMER 88 56899*************************************98874 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00043 | 6.6E-5 | 31 | 51 | IPR002112 | Transcription factor Jun |
Gene3D | G3DSA:1.20.5.170 | 2.7E-13 | 40 | 93 | No hit | No description |
Pfam | PF00170 | 5.9E-11 | 42 | 89 | IPR004827 | Basic-leucine zipper domain |
SMART | SM00338 | 8.4E-6 | 42 | 95 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.852 | 44 | 93 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.83E-10 | 45 | 93 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 49 | 64 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00043 | 6.6E-5 | 53 | 69 | IPR002112 | Transcription factor Jun |
PRINTS | PR00043 | 6.6E-5 | 71 | 83 | IPR002112 | Transcription factor Jun |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MPISGAGTSM RREVEVSHGI MIPSNMIVNH GGRKRIIEGS EEDEMRKERK KIKNRASAAR 60 SREKKVERTK FLEEKVEELR EENAQMERLV KLLVIHAPFF V |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 55072.m000012 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002537820.2 | 2e-58 | jun dimerization protein 2, partial | ||||
TrEMBL | B9THV1 | 3e-64 | B9THV1_RICCO; Uncharacterized protein | ||||
STRING | XP_002537820.1 | 5e-65 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF27059 | 2 | 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 55072.m000012 |