PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30147.m014133 | ||||||||
Common Name | LOC8258322, RCOM_1497850 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 213aa MW: 24764.5 Da PI: 9.8336 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.5 | 2e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+l e++s 30147.m014133 10 RIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLSEFAS 59 8***********************************************86 PP | |||||||
2 | K-box | 77.1 | 4.6e-26 | 81 | 174 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + ++e++ ++l++e+a L k+ie+L+ +qR+llG++L+s+s++eLq++ +qLe+sl++iRs+K +l++eq+e+l+ ke+ l een +Lr+k +e 30147.m014133 81 SVAKEQHVQELTEESAALVKKIEELEISQRKLLGQGLSSCSIEELQEIHSQLERSLSNIRSRKVQLFKEQMEQLKAKERLLLEENIRLREKCAE 174 447899************************************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.469 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.02E-32 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.46E-40 | 3 | 72 | No hit | No description |
PRINTS | PR00404 | 3.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.1E-25 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.543 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0032440 | Molecular Function | 2-alkenal reductase [NAD(P)] activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MVRGKIQMRR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ KGRLSEFASN 60 EMQKTIERYR KHAKEVQAAG SVAKEQHVQE LTEESAALVK KIEELEISQR KLLGQGLSSC 120 SIEELQEIHS QLERSLSNIR SRKVQLFKEQ MEQLKAKERL LLEENIRLRE KCAENHWQHP 180 TQRKEIKTYL NSSSKKKSEV ETELFIGLPE MHC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
5f28_C | 3e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_D | 3e-20 | 1 | 72 | 1 | 72 | MEF2C |
6byy_A | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 3e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30147.m014133 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002510866.1 | 1e-151 | MADS-box protein AGL42 | ||||
Swissprot | Q9FIS1 | 5e-84 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | B9R9J1 | 1e-150 | B9R9J1_RICCO; Mads box protein, putative | ||||
STRING | XP_002510866.1 | 1e-151 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-79 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30147.m014133 |
Entrez Gene | 8258322 |