PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30076.m004701 | ||||||||
Common Name | LOC8265164, RCOM_1348190 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 122aa MW: 13733.8 Da PI: 9.9918 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.6 | 3.5e-18 | 31 | 65 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C C+tt Tp+WR+gp g+ktLCnaCG++yrkk + 30076.m004701 31 CIDCQTTRTPCWRSGPAGPKTLCNACGIRYRKKSR 65 889*****************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 2.99E-14 | 24 | 66 | No hit | No description |
SMART | SM00401 | 2.0E-13 | 25 | 75 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.0E-15 | 26 | 80 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 11.82 | 29 | 61 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 3.26E-13 | 30 | 81 | No hit | No description |
Pfam | PF00320 | 5.5E-16 | 31 | 65 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 31 | 56 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MMIFDLNTNV QESGMDKNQN STTSSEFKKS CIDCQTTRTP CWRSGPAGPK TLCNACGIRY 60 RKKSRRILGV EKGGAEKRKG KLVKAAEVRY KDIFQEQWKR KLGEEEQAAF LLMALSYGCV 120 SA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30076.m004701 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002515326.1 | 4e-87 | GATA transcription factor 16 isoform X2 | ||||
Swissprot | Q9FJ10 | 6e-28 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | B9RNI7 | 9e-86 | B9RNI7_RICCO; GATA transcription factor, putative | ||||
STRING | XP_002515326.1 | 1e-86 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 2e-30 | GATA transcription factor 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30076.m004701 |
Entrez Gene | 8265164 |
Publications ? help Back to Top | |||
---|---|---|---|
|