PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30074.m001347 | ||||||||
Common Name | RCOM_1329560 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 173aa MW: 19235.4 Da PI: 9.9801 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 120.7 | 9.6e-38 | 76 | 171 | 20 | 115 |
Whirly 20 aldsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnsl 115 +++sg+lk++r+G +ll++ +a++erkyd+ek+qsfals+tev++l++l++k+s + fhdp++ +sn+G+vrk+l+++P+++G G+f++ls n++ 30074.m001347 76 TVQSGHLKVERRGVILLTFLPAIGERKYDYEKRQSFALSTTEVGSLISLGPKDSFDCFHDPGMLSSNAGEVRKSLSLKPHAEGGGYFISLSSWNNV 171 678***************************************************************************************987765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF54447 | 3.61E-29 | 76 | 171 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene3D | G3DSA:2.30.31.10 | 4.4E-36 | 76 | 172 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 5.6E-36 | 76 | 171 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MMKLSRLLQQ SRNSLGKSID ARDASALHDL TFRAGISTFR QDFTIKGSLS NEYMLLIPFT 60 REKXXGSNNV SLHSHTVQSG HLKVERRGVI LLTFLPAIGE RKYDYEKRQS FALSTTEVGS 120 LISLGPKDSF DCFHDPGMLS SNAGEVRKSL SLKPHAEGGG YFISLSSWNN VNM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4kop_A | 8e-43 | 77 | 171 | 36 | 130 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_B | 8e-43 | 77 | 171 | 36 | 130 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_C | 8e-43 | 77 | 171 | 36 | 130 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_D | 8e-43 | 77 | 171 | 36 | 130 | Single-stranded DNA-binding protein WHY2, mitochondrial |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30074.m001347 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025013600.1 | 1e-89 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
Swissprot | D9J034 | 8e-45 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | B9S6Y6 | 1e-122 | B9S6Y6_RICCO; Uncharacterized protein | ||||
STRING | XP_002521755.1 | 1e-123 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11383 | 33 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 2e-44 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30074.m001347 |