PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30055.m001589 | ||||||||
Common Name | LOC8271947, RCOM_1281990 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 214aa MW: 24281 Da PI: 7.9701 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.6 | 3.2e-09 | 9 | 54 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 +W+ Ed+l+ +a ++ + +W++Ia++++ g+++ ++k+++ + 30055.m001589 9 SWSRLEDKLFERALVVFPEEtpdRWEKIASHVP-GKSRFDVKEHYED 54 7*****************99*************.***********76 PP | |||||||
2 | Myb_DNA-binding | 43.2 | 9.4e-14 | 109 | 153 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r Rt+ q+ s+ qky 30055.m001589 109 PWTEEEHRLFLIGLQRYGKGDWRSISRNAVVSRTPTQVASHAQKY 153 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.055 | 5 | 60 | IPR017884 | SANT domain |
SMART | SM00717 | 8.6E-9 | 6 | 58 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.05E-11 | 6 | 56 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.8E-5 | 8 | 55 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.6E-8 | 9 | 55 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.33E-8 | 9 | 56 | No hit | No description |
PROSITE profile | PS51294 | 18.513 | 102 | 158 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.56E-17 | 104 | 159 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.1E-17 | 106 | 156 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 8.1E-10 | 106 | 156 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-12 | 106 | 152 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.00E-9 | 109 | 154 | No hit | No description |
Pfam | PF00249 | 2.3E-11 | 109 | 153 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MIGASPSSSW SRLEDKLFER ALVVFPEETP DRWEKIASHV PGKSRFDVKE HYEDLVYDVK 60 EIDSGRVELP SYGDQFGLGW GAAESGTSQV WFGSKGKEKE TSERRKGVPW TEEEHRLFLI 120 GLQRYGKGDW RSISRNAVVS RTPTQVASHA QKYFLRLNSV KKEKKRPSIH DITTSANSVP 180 PQSNDHNWAD YMDPKPYPDH GSPSSAFHGF GFPV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-15 | 10 | 72 | 11 | 73 | RADIALIS |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 159 | 166 | VKKEKKRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30055.m001589 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002523835.1 | 1e-157 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 1e-63 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | B9SCW6 | 1e-156 | B9SCW6_RICCO; DNA binding protein, putative | ||||
STRING | XP_002523835.1 | 1e-157 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6068 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 5e-71 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30055.m001589 |
Entrez Gene | 8271947 |
Publications ? help Back to Top | |||
---|---|---|---|
|