PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29957.m001404 | ||||||||
Common Name | RCOM_1134560 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 88aa MW: 10096.8 Da PI: 10.7697 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 35.5 | 1.3e-11 | 24 | 78 | 111 | 165 |
GRAS 111 rvHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerL 165 rvH+ D ++++G+QWpaLlqa++s+++ ++++ i g++++++ + l+e+g++L 29957.m001404 24 RVHVTDSSMNHGMQWPALLQAFSSQTRWSARFPINRNGAASHDNLDHLQEVGWKL 78 8*************************************99999***********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 10.914 | 1 | 88 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 4.7E-9 | 24 | 78 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MCKVATYVAE ALARRIYRLY PKLRVHVTDS SMNHGMQWPA LLQAFSSQTR WSARFPINRN 60 GAASHDNLDH LQEVGWKLGP MILFGKKL |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 29957.m001404 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015580029.2 | 4e-20 | LOW QUALITY PROTEIN: DELLA protein GAIP-B | ||||
TrEMBL | B9RVE4 | 3e-60 | B9RVE4_RICCO; Uncharacterized protein | ||||
STRING | XP_002517713.1 | 5e-61 | (Ricinus communis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01570.1 | 2e-17 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29957.m001404 |