PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29917.m001993 | ||||||||
Common Name | LOC8281783, RCOM_1064100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 175aa MW: 19271.7 Da PI: 7.8208 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 140.9 | 4.3e-44 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++ 29917.m001993 12 PCAACKFLRRKCLPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELDA 107 7*********************************************************************************************99 PP DUF260 97 lke 99 +++ 29917.m001993 108 TNA 110 876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.588 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.8E-43 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MMASSSAYSN SPCAACKFLR RKCLPDCIFA PYFPPEEPQK FANVHKIFGA SNVSKLLNEV 60 LPHQREDAVN SLAYEAEARM KDPVYGCVGA ISVLQRQVIR LQKELDATNA DLIRYACNDQ 120 MPPPPPTITS SSSSQFGRRS GHGSGVSYDQ NSGFYYPPPW NNHDDIQGRG GHGSM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-67 | 3 | 130 | 2 | 131 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-67 | 3 | 130 | 2 | 131 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 29917.m001993 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002521459.1 | 1e-130 | LOB domain-containing protein 25 | ||||
Refseq | XP_025013536.1 | 1e-130 | LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 1e-70 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | B9S640 | 1e-128 | B9S640_RICCO; LOB domain-containing protein, putative | ||||
STRING | XP_002521459.1 | 1e-129 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 3e-70 | LOB domain-containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29917.m001993 |
Entrez Gene | 8281783 |
Publications ? help Back to Top | |||
---|---|---|---|
|