PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29889.m003351 | ||||||||
Common Name | RCOM_1002180 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 83aa MW: 9347.35 Da PI: 6.5192 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 34 | 63 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 rg+WT eEd +l+++++ G g+W++ ar 29889.m003351 34 RGPWTVEEDFKLINYIATQGEGRWNSLARS 63 89*************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 7.062 | 29 | 62 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 1.05E-7 | 32 | 63 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.0E-9 | 32 | 64 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-6 | 34 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.50E-5 | 36 | 62 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MDVKVTHSNN QKSSSSSTTT ATQSEDEMMS ELRRGPWTVE EDFKLINYIA TQGEGRWNSL 60 ARSAAKQQLA NLSWIIYNGL SLH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 29889.m003351 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025013100.1 | 6e-37 | transcription factor MYB108 | ||||
Swissprot | Q9LDE1 | 8e-16 | MY108_ARATH; Transcription factor MYB108 | ||||
TrEMBL | B9RZW0 | 2e-54 | B9RZW0_RICCO; R2r3-myb transcription factor, putative | ||||
STRING | XP_002519279.1 | 4e-55 | (Ricinus communis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06490.1 | 2e-17 | myb domain protein 108 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29889.m003351 |
Publications ? help Back to Top | |||
---|---|---|---|
|