PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29838.m001690
Common NameRCOM_0885720
Organism
Ricinus communis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 61aa    MW: 7042.28 Da    PI: 10.9484
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29838.m001690genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.4e-28959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   k+i+n + rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+ey+s
  29838.m001690  9 KKIDNITARQVTFSKRRRGLFKKAYELSTLCDAEIALLVFSATGKLFEYAS 59
                   68***********************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.688161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-28260IPR002100Transcription factor, MADS-box
CDDcd002656.48E-34360No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0032440Molecular Function2-alkenal reductase [NAD(P)] activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MTRQKIQIKK IDNITARQVT FSKRRRGLFK KAYELSTLCD AEIALLVFSA TGKLFEYASS  60
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-21160160MEF2C
5f28_B6e-21160160MEF2C
5f28_C6e-21160160MEF2C
5f28_D6e-21160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29838.m001690
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3346331e-57EU334633.1 Euphorbia esula dormancy associated MADS-box protein (DAM1) gene, complete cds.
GenBankJX9663511e-57JX966351.1 Euphorbia esula clone BAC_DAM3 DAM3 (DAM3) gene, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576953.18e-36MADS-box protein SVP
RefseqXP_025013770.18e-36MADS-box protein SVP
RefseqXP_025013771.18e-36MADS-box protein SVP
SwissprotO827948e-30AGL24_ARATH; MADS-box protein AGL24
TrEMBLB9S9I48e-36B9S9I4_RICCO; Mads box protein, putative
STRINGXP_002522653.11e-36(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.13e-32AGAMOUS-like 24
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  3. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  4. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]
  5. Sun LM,Zhang JZ,Hu CG
    Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.).
    Front Plant Sci, 2016. 7: p. 823
    [PMID:27375669]