PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29807.m000482
Common NameLOC8276206, RCOM_0826140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 536aa    MW: 58616.7 Da    PI: 5.1731
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29807.m000482genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.68.2e-1301485141374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                    lv+lL++cAe ++ gdl+la +l++ ++ l  + ++ + + ++a +f  AL+ r+++ v+++  a+ +s+       e+ + ++ f+e++P+lkf+
  29807.m000482 148 LVHLLMTCAESIQRGDLSLAGSLVEDMQALltRVNTNSGIGKVAGCFIDALSLRIFSPVNGVGVAVGASAY------ENEFLYHHFYEACPYLKFA 237
                    68***************************9766667789******************88888866655555......46678899*********** PP

           GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                    h+taNqaIlea++g+++vH++Df++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g +La++A++++v+f f+ ++a+rled++
  29807.m000482 238 HFTANQAILEAFDGHDCVHVVDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGVKLAELARSVNVRFAFRGVAASRLEDVK 333
                    ************************************************************************************************ PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +++L+v+p+Ea+aVn+++qlh+ll ++ + +  +d vL+ +++l+Pk+++vveqea+hn++ Fl+rf+eal+yys++fdsl a    + + +++v 
  29807.m000482 334 PWMLQVNPKEAIAVNSIMQLHKLLGSDPNRNLSIDMVLNWIRNLNPKIMTVVEQEANHNQPGFLDRFTEALYYYSTMFDSLGAC---ALQPEKVVA 426
                    ************************99999999*************************************************887...358888999 PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++++rei+nvv+ceg++r erhe l+kW++rl++aGF p++l+++a kqa++ll  ++s+gy vee++g+l+lgW++rpL+++SaW+
  29807.m000482 427 EMYIQREICNVVSCEGSARLERHEPLAKWKSRLTAAGFMPLHLGSNAFKQASMLLTLFSSEGYCVEENDGCLTLGWHSRPLIAASAWQ 514
                    999************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.9E-323097IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.9E-1930103No hitNo description
PROSITE profilePS5098562.587122494IPR005202Transcription factor GRAS
PfamPF035142.8E-127148514IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MVLYESSDSS TSNPLSSSSS SITNKPPEID NLLAGAGYKV RSSDLRHVAQ RLERLETAML  60
NSPSSHLSVL ASDTVLYNPS DLSSWVDSLL TEFNQSQPLP SLPPDLSDLI VPNPTVDNNS  120
WNLEHQNLSP QNQLRVVTAT EEDSAIRLVH LLMTCAESIQ RGDLSLAGSL VEDMQALLTR  180
VNTNSGIGKV AGCFIDALSL RIFSPVNGVG VAVGASAYEN EFLYHHFYEA CPYLKFAHFT  240
ANQAILEAFD GHDCVHVVDF NLMHGLQWPA LIQALALRPG GPPLLRLTGI GPPSPDGRDS  300
LREIGVKLAE LARSVNVRFA FRGVAASRLE DVKPWMLQVN PKEAIAVNSI MQLHKLLGSD  360
PNRNLSIDMV LNWIRNLNPK IMTVVEQEAN HNQPGFLDRF TEALYYYSTM FDSLGACALQ  420
PEKVVAEMYI QREICNVVSC EGSARLERHE PLAKWKSRLT AAGFMPLHLG SNAFKQASML  480
LTLFSSEGYC VEENDGCLTL GWHSRPLIAA SAWQAVPDIG SPLGIISGNI NDGVGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-6215551326378Protein SCARECROW
5b3h_A1e-6215551325377Protein SCARECROW
5b3h_D1e-6215551325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Transcription coactivator of the zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling (PubMed:25035403). No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression. In contrast to RGA, it is less sensitive to GA. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269|PubMed:11487693, ECO:0000269|PubMed:11606551, ECO:0000269|PubMed:11606552, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:17933900, ECO:0000269|PubMed:25035403, ECO:0000269|PubMed:9389651}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29807.m000482
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529354.10.0DELLA protein SLN1
SwissprotQ9LQT81e-161GAI_ARATH; DELLA protein GAI
TrEMBLB9STN50.0B9STN5_RICCO; DELLA protein GAI1, putative
STRINGXP_002529354.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-141GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gallego-Giraldo C, et al.
    Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis.
    Plant J., 2014. 79(6): p. 1020-1032
    [PMID:24961590]
  4. Fukazawa J, et al.
    DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.
    Plant Cell, 2014. 26(7): p. 2920-38
    [PMID:25035403]
  5. MarĂ­n-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  6. Shi H,Wei Y,Wang Q,Reiter RJ,He C
    Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis.
    J. Pineal Res., 2016. 60(3): p. 373-9
    [PMID:26887824]
  7. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  8. Qu J,Kang SG,Hah C,Jang JC
    Molecular and cellular characterization of GA-Stimulated Transcripts GASA4 and GASA6 in Arabidopsis thaliana.
    Plant Sci., 2016. 246: p. 1-10
    [PMID:26993231]
  9. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  10. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  11. Wang H, et al.
    The DELLA-CONSTANS Transcription Factor Cascade Integrates Gibberellic Acid and Photoperiod Signaling to Regulate Flowering.
    Plant Physiol., 2016. 172(1): p. 479-88
    [PMID:27406167]
  12. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  13. Liu B,De Storme N,Geelen D
    Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis.
    Plant Physiol., 2017. 173(1): p. 338-353
    [PMID:27621423]
  14. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]
  15. Zentella R, et al.
    The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
    Nat. Chem. Biol., 2017. 13(5): p. 479-485
    [PMID:28244988]
  16. Zhang Y, et al.
    GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation.
    Plant Cell Rep., 2017. 36(4): p. 557-569
    [PMID:28275852]
  17. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]
  18. Nelson SK,Ariizumi T,Steber CM
    Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant.
    Front Plant Sci, 2017. 8: p. 2158
    [PMID:29312402]
  19. Liu B,De Storme N,Geelen D
    Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling.
    Front Plant Sci, 2018. 9: p. 91
    [PMID:29459879]
  20. Zhang Y, et al.
    DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6.
    Plant Cell Rep., 2018. 37(7): p. 981-992
    [PMID:29574486]
  21. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]
  22. Wright DA, et al.
    Recovery of YAC-end sequences through complementation of an Escherichia coli pyrF mutation.
    Nucleic Acids Res., 1997. 25(13): p. 2679-80
    [PMID:9185581]