PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29767.m000200
Common NameLOC8260239, RCOM_0760840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 740aa    MW: 83933.9 Da    PI: 8.3126
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29767.m000200genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.28.2e-1153687381374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lL++cA+av+++d + a ++L+++++++sp gd +qRla++f+++L arla+++s++yk l +++ts    +++l+a++l+  ++P+ k++++
  29767.m000200 368 LRTLLISCAQAVAADDRRSAYEMLKQIRQHSSPFGDGNQRLAHCFANGLDARLAGTGSQIYKGLVSKRTS---AANVLKAYHLYLAACPFRKLTNF 460
                    6789************************************************************999999...8999******************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                    + N++I+e  +++  +HiiDf+i +G+QWp+L+q L+ Rp++ p++RiTg++ p++g   +e++eetg+rLa +A++++vpfe+n+ +ak++e+++
  29767.m000200 461 LSNKTIMELSANSASIHIIDFGILYGFQWPTLIQRLSWRPKP-PKVRITGIDFPQPGfrPAERVEETGRRLATYAKKFNVPFEYNA-IAKKWETIK 554
                    ***************************************976.9************9*****************************.7******** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +eeL+++++E ++V + ++ ++llde+v ++s++d vL+lvk+++P+++++   +  ++++ F +rf eal ++s+lfd+l++ +pre+ er+ +E
  29767.m000200 555 FEELKIDREEIIVVTCFYRAKNLLDETVVVDSPKDIVLRLVKKINPNIFILGIINGAYSAPFFITRFREALFHFSSLFDMLDSIVPREDMERMLIE 650
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +e++gre+ nvvaceg er+er et+++W+ r  +aGF +++++ +++kqa   +rk + + + ++e+  +l++gWk+r ++++SaW+
  29767.m000200 651 KEIIGREALNVVACEGWERVERPETYKQWQVRALRAGFVQLSFDREIVKQAIEKVRKLYHKNFLINEDGRWLLQGWKGRIIYALSAWK 738
                    ***********************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.334342718IPR005202Transcription factor GRAS
PfamPF035142.8E-112368738IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MDPSLRGFAS TTNGTQLGNQ PVSVLSNQSL VVPVHRFENS SKNRNFIEFP YHPTNSKSSS  60
VNPNSNGNHE EDSPEDCDFS DTVLRYISQM LMEEDIEDKT CMLQDSLDLQ AAEKSFYEVL  120
GKKYPPSPEP KRVSICQKVE NPYDSFSSNS STSTYLDDNS SIQNLCHYNS FPPQAIGINI  180
SPSSYGSSNS EITSTDGLVH SPNSTFPVPH WNNESQSISQ FIKGVEEASK FLPNGDDLFR  240
NIEVNRFLFK EPKSSSSRFT IKEERNDEGE YSPGGRRGRK NPYRENGDIE DARSSKQPAI  300
YVESDMEEHA VDKMLLYSAG EGKKDFSDLC ESLKNAAIKS EHNGQSKGCK GGKGRGKKHN  360
GKKEVVDLRT LLISCAQAVA ADDRRSAYEM LKQIRQHSSP FGDGNQRLAH CFANGLDARL  420
AGTGSQIYKG LVSKRTSAAN VLKAYHLYLA ACPFRKLTNF LSNKTIMELS ANSASIHIID  480
FGILYGFQWP TLIQRLSWRP KPPKVRITGI DFPQPGFRPA ERVEETGRRL ATYAKKFNVP  540
FEYNAIAKKW ETIKFEELKI DREEIIVVTC FYRAKNLLDE TVVVDSPKDI VLRLVKKINP  600
NIFILGIING AYSAPFFITR FREALFHFSS LFDMLDSIVP REDMERMLIE KEIIGREALN  660
VVACEGWERV ERPETYKQWQ VRALRAGFVQ LSFDREIVKQ AIEKVRKLYH KNFLINEDGR  720
WLLQGWKGRI IYALSAWKPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A9e-4737573926380Protein SCARECROW
5b3h_A7e-4737573925379Protein SCARECROW
5b3h_D7e-4737573925379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29767.m000200
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015581974.10.0scarecrow-like protein 9
RefseqXP_015581975.10.0scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLB9SYB30.0B9SYB3_RICCO; Uncharacterized protein
STRINGXP_002530982.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein