PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29751.m001877 | ||||||||
Common Name | RCOM_0733010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 84aa MW: 8873.82 Da PI: 10.0898 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 34.2 | 7.9e-11 | 1 | 30 | 246 | 275 |
GAGA_bind 246 vstkrrgaRiagrKmSqgafkklLekLaae 275 +stk gaRiagrKm qgafkk+L+kL ae 29751.m001877 1 MSTKIHGARIAGRKMCQGAFKKVLKKLVAE 30 79999**********************988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 2.1E-9 | 1 | 31 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016021 | Cellular Component | integral component of membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MSTKIHGARI AGRKMCQGAF KKVLKKLVAE ETVVHFGCCR QKQCGGGDVL VDIGWVCALL 60 AHFRGGLLAV AVAVAVVLLV LLVT |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 29751.m001877 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | B9S3E4 | 1e-50 | B9S3E4_RICCO; Uncharacterized protein | ||||
STRING | XP_002520513.1 | 2e-51 | (Ricinus communis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01930.2 | 2e-09 | basic pentacysteine1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29751.m001877 |