PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29648.m001919
Common NameLOC8270417, RCOM_0559420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 559aa    MW: 62597.5 Da    PI: 4.6337
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29648.m001919genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.41.5e-1381905593374
           GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    +lLlecA+a+++++ e+a+al+++l++++s +gdp  R+aay++e+Laar+a s++ lykal+++e +   ss++laa+++++e++P++kf++++a
  29648.m001919 190 RLLLECANALAEDNIEAADALINELRQMVSIQGDPSSRIAAYMVEGLAARMAASGKYLYKALKCKEPP---SSDRLAAMQILFEICPCFKFGFMAA 282
                    79*****************************************************************9...9************************ PP

           GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    N a+ e+++ge+ vHiiDfdi+qG Q+++L+q+La++p++pp+lR+Tg+++pes+  s+  l+ +g+rL+k+Ae+l+vpfef++ va++++ ++++
  29648.m001919 283 NGAMIESFKGEKGVHIIDFDINQGSQYITLIQTLANQPGKPPHLRLTGIDDPESVqrSTGGLKIIGQRLEKLAEALKVPFEFHA-VASKTSLVSPS 377
                    *****************************************************9999999************************.7********** PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                    +L++k gEal+Vn+++qlh+++desvs+ +erd++L++vksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+f+sl+a+lpres++r++vE++
  29648.m001919 378 MLDCKAGEALVVNFAFQLHHMPDESVSTVNERDQLLRMVKSLNPKLVTVVEQDVNTNTAPFFPRFVEAYNYYSAVFESLDATLPRESQDRMNVEKQ 473
                    ************************************************************************************************ PP

           GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ +++ ++++ ++ ++++ + d y+++ee g+l++gW+d++L+++SaWr
  29648.m001919 474 CLARDIVNIVACEGDERIERYEVAGKWRARMTMAGFTSSSMGPNVVDMIRKVIKQQYCDRYKLKEEMGALLFGWEDKSLIVASAWR 559
                    *********************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.68162539IPR005202Transcription factor GRAS
PfamPF035145.1E-136190559IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MSLVRPAELS ATSYRNHKLY SLNGSNDNSG LSTQMFGTDK RKTIYMTESY SSESYEKYFI  60
DSPTDELIQL SSSSISGNSF HLQDASSYQL RTESDYVEFQ SPDLVDYDAD EMRLKLQELE  120
RALLDDNEDD DDNDMFGNSH SMEIDGEWCE PIQNVMLHDS PKESSSSDSN SSSTSSNKEV  180
SQLSPRAPKR LLLECANALA EDNIEAADAL INELRQMVSI QGDPSSRIAA YMVEGLAARM  240
AASGKYLYKA LKCKEPPSSD RLAAMQILFE ICPCFKFGFM AANGAMIESF KGEKGVHIID  300
FDINQGSQYI TLIQTLANQP GKPPHLRLTG IDDPESVQRS TGGLKIIGQR LEKLAEALKV  360
PFEFHAVASK TSLVSPSMLD CKAGEALVVN FAFQLHHMPD ESVSTVNERD QLLRMVKSLN  420
PKLVTVVEQD VNTNTAPFFP RFVEAYNYYS AVFESLDATL PRESQDRMNV EKQCLARDIV  480
NIVACEGDER IERYEVAGKW RARMTMAGFT SSSMGPNVVD MIRKVIKQQY CDRYKLKEEM  540
GALLFGWEDK SLIVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6919455825378Protein SCARECROW
5b3h_A2e-6919455824377Protein SCARECROW
5b3h_D2e-6919455824377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29648.m001919
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520249.10.0scarecrow-like protein 1
RefseqXP_015575394.10.0scarecrow-like protein 1
RefseqXP_025013315.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLB9S2N00.0B9S2N0_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGXP_002520249.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]