PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28966.m000535
Common NameRCOM_0364340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 160aa    MW: 17305.2 Da    PI: 6.3387
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28966.m000535genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS25.71.3e-0866107142
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRla 42 
                    +++lL++cAe +s++d+++a++l++ ls  +sp+gd+ +R a
  28966.m000535  66 MRQLLISCAELISQSDFSAAHRLISVLSSSSSPYGDSRERSA 107
                    689************************************976 PP

2GRAS55.51.2e-17105159320373
           GRAS 320 eeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                    ++aGF++vpls +a +qaklllr ++ s+gy+++  ++s++lgW++r+L+svS+W
  28966.m000535 105 RSAGFNNVPLSPYALSQAKLLLRLHYpSEGYHLQMINDSFFLGWQNRALFSVSSW 159
                    579**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035144.1E-15105159IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MLGSLNSSSS SPHEQDQQEE ATAVLDLQFQ QIINPQATAA AAATRAAATT TSTTSVGGFT  60
SSAIYMRQLL ISCAELISQS DFSAAHRLIS VLSSSSSPYG DSRERSAGFN NVPLSPYALS  120
QAKLLLRLHY PSEGYHLQMI NDSFFLGWQN RALFSVSSWH
Cis-element ? help Back to Top
SourceLink
PlantRegMap28966.m000535
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021636879.13e-28scarecrow-like protein 18
TrEMBLB9ST941e-111B9ST94_RICCO; Uncharacterized protein
STRINGXP_002529213.11e-112(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.12e-23GRAS family protein