PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 28644.m000915 | ||||||||
Common Name | LOC8281407, RCOM_0297030 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 168aa MW: 19402.4 Da PI: 5.5865 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 92.8 | 2.6e-29 | 107 | 165 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K vk+s++pr+Y++C agC+vkk v+r++edp++v++tYeg Hnhe 28644.m000915 107 MDDGYRWRKYGKKAVKNSRNPRNYFKCLKAGCNVKKTVQRDTEDPDYVTTTYEGMHNHE 165 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.8E-31 | 93 | 166 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.79E-26 | 100 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.508 | 102 | 167 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.4E-31 | 107 | 166 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-23 | 108 | 165 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MSDSNCSSFL EANTPHNPNN FNHLDNYETE TDIIDHENFE PFDLMVAEEL ESDFTSILAE 60 LQQEITTNNT ILSTPDVPRR HESGGKGVKI DERKRIAFRT KSGIDIMDDG YRWRKYGKKA 120 VKNSRNPRNY FKCLKAGCNV KKTVQRDTED PDYVTTTYEG MHNHEALH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-23 | 97 | 165 | 7 | 75 | Probable WRKY transcription factor 4 |
2lex_A | 2e-23 | 97 | 165 | 7 | 75 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 28644.m000915 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025014534.1 | 6e-91 | probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 2e-32 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | B9SM87 | 1e-124 | B9SM87_RICCO; WRKY transcription factor, putative | ||||
STRING | XP_002527106.1 | 1e-124 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 8e-35 | WRKY DNA-binding protein 51 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 28644.m000915 |
Entrez Gene | 8281407 |
Publications ? help Back to Top | |||
---|---|---|---|
|