PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28166.m001040
Common NameRCOM_0180000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 459aa    MW: 51523.1 Da    PI: 6.6667
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28166.m001040genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS61.41.8e-19199289194
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                    l++lL++cA+a+s+++ ++ ++l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +   s++ l+++++++e++P+lkf+
  28166.m001040 199 LKQLLIACAKALSENNINEFDRLIEKARAAVSISGEPIQRLGAYLVEGLVARKESSGNNIYHALRCREPE---SKDLLSYMQILYEICPYLKFG 289
                    689******************************************************************9...9*******************8 PP

2GRAS191.36.4e-59298458212373
           GRAS 212 rlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerre 307
                       desv+++++rd +L+++ksl+Pkvv++veqe+++n+++Fl+rf+e+l++y a+f+s+++ lpre ++ri vE+++l+++ivn++aceg+er+e
  28166.m001040 298 PHSDESVDVSNPRDGLLRMIKSLNPKVVTLVEQESNTNTTPFLTRFMETLDFYLAMFESIDVRLPRERKDRIGVEQHCLAKDIVNIIACEGKERVE 393
                    567899****************************************************************************************** PP

           GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    rhe ++kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lgWk+r+Lvs+SaW
  28166.m001040 394 RHELFGKWKSRLTMAGFRQYPLSSYVNSVIRSLLRCYS-EHYTLLEKDGAMLLGWKNRNLVSASAW 458
                    **********************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035146.4E-17199289IPR005202Transcription factor GRAS
PfamPF035142.2E-56298458IPR005202Transcription factor GRAS
PROSITE profilePS5098522.637301440IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MESHPLFRYS SVTGAGISYS SSYPIAPSIP NRLSGPFQFA IGNSPNSPFS NQFDCDTITT  60
LSDSTEQYSP TENLSGASPS CNSSLESNNY FHHRSPSLLQ DANSGQNIKH RLLQLETALM  120
GPDDEDISMP NNALGESSRP QTSGQRTRAW CQERQGSRVI QPQPSFVSRQ RQACEGSSVE  180
KYHKGIEETG LQSIPPDNLK QLLIACAKAL SENNINEFDR LIEKARAAVS ISGEPIQRLG  240
AYLVEGLVAR KESSGNNIYH ALRCREPESK DLLSYMQILY EICPYLKFGC ELPLAASPHS  300
DESVDVSNPR DGLLRMIKSL NPKVVTLVEQ ESNTNTTPFL TRFMETLDFY LAMFESIDVR  360
LPRERKDRIG VEQHCLAKDI VNIIACEGKE RVERHELFGK WKSRLTMAGF RQYPLSSYVN  420
SVIRSLLRCY SEHYTLLEKD GAMLLGWKNR NLVSASAWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-21305458226378Protein SCARECROW
5b3h_A5e-21305458225377Protein SCARECROW
5b3h_D5e-21305458225377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap28166.m001040
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577067.10.0LOW QUALITY PROTEIN: scarecrow-like protein 21
SwissprotQ69VG12e-86CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLB9S9Z50.0B9S9Z5_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGXP_002522814.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.14e-74SCARECROW-like 21
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]