PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 28040.m000035 | ||||||||
Common Name | RCOM_0148890 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 103aa MW: 12412.2 Da PI: 10.3365 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105 | 4.1e-33 | 26 | 84 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ 28040.m000035 26 LDDGYKWRKYGQKVVKNTLHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 84 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.1E-34 | 11 | 84 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-29 | 18 | 85 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.356 | 21 | 86 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.2E-37 | 26 | 85 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-26 | 27 | 83 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MKKIKARRKV REPRFCFKTM SDVDVLDDGY KWRKYGQKVV KNTLHPRSYY RCTQDNCRVK 60 KRVERLAEDP RMVITTYEGR HAHSPSHDLE DSQAQSQLNN FFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 17 | 83 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 17 | 83 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 28040.m000035 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002534045.2 | 3e-73 | probable WRKY transcription factor 13 | ||||
Swissprot | Q9SVB7 | 7e-56 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | B9T726 | 3e-72 | B9T726_RICCO; WRKY transcription factor, putative (Fragment) | ||||
TrEMBL | S5CK93 | 2e-71 | S5CK93_JATCU; WRKY transcription factor 15 | ||||
STRING | cassava4.1_015466m | 3e-71 | (Manihot esculenta) | ||||
STRING | XP_002534045.1 | 5e-73 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4079 | 33 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 3e-58 | WRKY DNA-binding protein 13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 28040.m000035 |