PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27568.m000253
Common NameLOC8258390, RCOM_0039810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 741aa    MW: 83116.3 Da    PI: 5.2383
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27568.m000253genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4033e-1233677381374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lL+ cA+av+++d ++++ lL++++++asp+gd mqR+a+ f+ +L+ar+a+s++++yka+ +++t+    +++l+a++lf  ++P+ k+s++
  27568.m000253 367 LRTLLTLCAQAVAADDRRNTNDLLKQIRQNASPTGDGMQRMAHIFADGLEARMAGSGTQIYKAFMSRPTT---AADVLKAHHLFLAACPFRKLSNF 459
                    5789*****************************************************************9...9********************** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      N++I++ +++++++HiiDf+i +G+QWp+L+q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rL+++A++++vpfefn+ +a+++++++
  27568.m000253 460 FSNKTIMNIAQNATTLHIIDFGILYGFQWPCLIQRLSSRPGGPPKLRITGIDFPHPGfrPAERVEETGHRLSNYAKKFNVPFEFNA-IAQKWDTVQ 554
                    *******************************************************9999***************************.7******** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +e+L+++++E+l+Vn+ ++l +llde+v +es+r++vL+l+++++P+v++    +  +n++ F +rf ea+ +ys+lfd+le+++pre  er+ +E
  27568.m000253 555 IEQLKIDKNEVLVVNCLYRLRNLLDETVVVESPRTNVLNLIREMNPDVFITGIVNGAYNAPFFITRFREAVFHYSTLFDMLETNVPREIPERMLIE 650
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    re++g+e++nv+acegaer+er et+++W+ r+ +aGF+++pl++++++ ak  ++  + + + ++e+s +l++gWk+r ++++S+W+
  27568.m000253 651 REIFGWEAKNVIACEGAERIERPETYKQWQVRILRAGFRQLPLNKEIYAAAKEKVNALYHKDFVIDEDSRWLLQGWKGRIVYALSSWE 738
                    ***********************************************************888*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.227341718IPR005202Transcription factor GRAS
PfamPF035141.0E-120367738IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MVMDQPLIGL YGSVSGLKLN DEILSVLSGQ ELDNGLQLDR DFVNQNYVKL PPYATPSFSV  60
SSSTASQDGD LHEDFDFSDV VLKYISDMLM EEDIEEKTCM FQESSAALQA AEKSLYELIG  120
EKYPPSINYD SAAHLVHNHR RSDENHDLNY VNCTSSSSST SGSNLVDPGL NSDLSEYKFS  180
RSVSQSASQS SNSSGYSIGT AADGLVDSPL STISEIFSDS ESILQFKKGF EEASKFLPNG  240
SLFIDLESTG LFLKDLREET KDVTTRAEEN HESEYSPDES RGKKNPHPDG LILEGRSNKQ  300
SAVYTETTVS SEDFDTVLLN CGESESALRV ALQNEKNKDV QQNGTKGSNS GKGRGKKQKG  360
KSNVVDLRTL LTLCAQAVAA DDRRNTNDLL KQIRQNASPT GDGMQRMAHI FADGLEARMA  420
GSGTQIYKAF MSRPTTAADV LKAHHLFLAA CPFRKLSNFF SNKTIMNIAQ NATTLHIIDF  480
GILYGFQWPC LIQRLSSRPG GPPKLRITGI DFPHPGFRPA ERVEETGHRL SNYAKKFNVP  540
FEFNAIAQKW DTVQIEQLKI DKNEVLVVNC LYRLRNLLDE TVVVESPRTN VLNLIREMNP  600
DVFITGIVNG AYNAPFFITR FREAVFHYST LFDMLETNVP REIPERMLIE REIFGWEAKN  660
VIACEGAERI ERPETYKQWQ VRILRAGFRQ LPLNKEIYAA AKEKVNALYH KDFVIDEDSR  720
WLLQGWKGRI VYALSSWEPD H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-5437473926380Protein SCARECROW
5b3h_A4e-5437473925379Protein SCARECROW
5b3h_D4e-5437473925379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap27568.m000253
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582337.10.0scarecrow-like protein 14 isoform X1
RefseqXP_015582338.10.0scarecrow-like protein 14 isoform X1
RefseqXP_015582339.10.0scarecrow-like protein 14 isoform X1
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9SZZ90.0B9SZZ9_RICCO; Uncharacterized protein
STRINGXP_002531568.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]