PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.011G109500.1 | ||||||||
Common Name | PHAVU_011G109500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 26577.2 Da PI: 5.1556 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.2 | 3.3e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++lvd+++++G +W++ ++ g+ R++k+c++rw++yl Phvul.011G109500.1 15 KGTWTPEEDQKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNYL 62 799*****************99************************97 PP | |||||||
2 | Myb_DNA-binding | 55.1 | 1.7e-17 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ ++eE+e ++++++ lG++ W++Ia++++ gRt++++k++w++ Phvul.011G109500.1 68 RGNYSEEEEETIIKLHRHLGNR-WSAIAARIP-GRTDNEIKNYWHTN 112 899*******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.772 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.03E-29 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.3E-15 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.06E-9 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 24.976 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 9.1E-17 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-16 | 68 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.97E-11 | 70 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-24 | 70 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MMVRTPSSDK NGLKKGTWTP EEDQKLVDYI TRYGHWNWRL LPKFAGLARC GKSCRLRWLN 60 YLRPNLKRGN YSEEEEETII KLHRHLGNRW SAIAARIPGR TDNEIKNYWH TNLKKRSEQD 120 SATDSQVSNS CEQSLTTTTE PSGNTFQSFN STQDYSPFSQ NSSSSITSTE CNTVTINENL 180 APQDEFAFWD ADTDLMTGNF WLESYMRDIS YVPNEPEYSF DAELWSHDN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-29 | 13 | 118 | 5 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.011G109500.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-97 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007132610.1 | 1e-172 | hypothetical protein PHAVU_011G109500g | ||||
Swissprot | Q7XBH4 | 6e-60 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | V7AGB3 | 1e-171 | V7AGB3_PHAVU; Uncharacterized protein | ||||
STRING | XP_007132610.1 | 1e-172 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF356 | 33 | 186 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 8e-61 | myb domain protein 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.011G109500.1 |
Entrez Gene | 18615817 |
Publications ? help Back to Top | |||
---|---|---|---|
|