PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Phvul.009G056400.1

Common Name

PHAVU_009G056400g

Organism

Phaseolus vulgaris

Taxonomic ID

3885

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus

Family

BES1

Protein Properties

Length: 325aa MW: 35523.6 Da PI: 9.2217

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Phvul.009G056400.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	207.3	4.3e-64	13	150	2	142
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspes 92 +++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++ + + a +s +++p s Phvul.009G056400.1 13 ANRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCIEAGWTVEEDGTTYRKGCRVPFPGDGADTSIRNTPFS 103 789**********************************************************************9*********** PP DUF822 93 slqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsv 142 s+++s+ ss+++sp++sy+ sp+sssfpsps+ld ++++ +l+p++++ Phvul.009G056400.1 104 SQNLSPLSSSFPSPIPSYQVSPSSSSFPSPSRLDDNNAS---NLIPYIRH 150 *********************************9886...56666555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	1.8E-59	14	143	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 325 aa Download sequence Send to blast
MTSDGATSAA AAANRRKPSW RERENNRRRE RRRRAIAAKI YTGLRAQGNY NLPKHCDNNE 60 VLKALCIEAG WTVEEDGTTY RKGCRVPFPG DGADTSIRNT PFSSQNLSPL SSSFPSPIPS 120 YQVSPSSSSF PSPSRLDDNN ASNLIPYIRH SFSASLPPLR ISNSAPVTPP LSSPTSRNPK 180 PIPTWDSIVK ASMASSFNHH HQNHPLFAAS APASPTHRQL HAPPTIPECD ESDTSTVESG 240 QWLNFQAFAP SVSAVPISPT LNFIKPVVSQ QHMHNLNHPD NRIQEMRNSE VQFGVQVKPW 300 VGERIHEGGL DDLELTLGSG KTLA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zd4_A	9e-33	15	98	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B	9e-33	15	98	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C	9e-33	15	98	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D	9e-33	15	98	371	453	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	14	33	RRKPSWRERENNRRRERRRR

Functional Description ? help Back to Top
Source	Description
UniProt	Positive regulator of brassinosteroid (BR) signaling. Transcription factor that activates target gene expression by binding specifically to the DNA sequence 5'-CANNTG-3'(E box) through its N-terminal domain. Can bind individually to the promoter as a homodimer or synergistically as a heterodimer with BIM1, BIM2 or BIM3. The C-terminal domain is probably involved in transcriptional activation (PubMed:12007405, PubMed:15680330, PubMed:18467490, PubMed:19170933). Recruits the transcription elongation factor IWS1 to control BR-regulated gene expression (PubMed:20139304). Forms a trimeric complex with IWS1 and ASHH2/SDG8 to regulate BR-regulated gene expression (PubMed:24838002). Promotes quiescent center (QC) self-renewal by cell divisions in the primary root. Binds to the E-boxes of the BRAVO promoter to repress its expression (PubMed:24981610). {ECO:0000269\|PubMed:12007405, ECO:0000269\|PubMed:15680330, ECO:0000269\|PubMed:18467490, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20139304, ECO:0000269\|PubMed:24838002, ECO:0000269\|PubMed:24981610}.
UniProt	Transcriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter. Regulates positively the brassinosteroid-signaling pathway. Mediates downstream growth responses and negative feedback regulation of brassinosteroid biosynthesis. Promotes growth. Modulates ovule initiation and development by monitoring the expression of genes related to ovule development (e.g. HLL, ANT, and AP2). {ECO:0000269\|PubMed:15681342, ECO:0000269\|PubMed:22914576}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Phvul.009G056400.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By brassinosteroid (BR). {ECO:0000269\|PubMed:15681342}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	0.0	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007136574.1	0.0	hypothetical protein PHAVU_009G056400g
Swissprot	Q8S307	1e-117	BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
Swissprot	Q9LN63	1e-117	BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBL	V7AVE4	0.0	V7AVE4_PHAVU; Uncharacterized protein
STRING	XP_007136574.1	0.0	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1275	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G19350.3	3e-95	BES1 family protein

Link Out ? help Back to Top
Phytozome	Phvul.009G056400.1
Entrez Gene	18619246

Publications ? help Back to Top
Wang H, et al. Dual role of BKI1 and 14-3-3 s in brassinosteroid signaling to link receptor with transcription factors. Dev. Cell, 2011. 21(5): p. 825-34 [PMID:22075146] Liu L, et al. Ectopic expression of a BZR1-1D transcription factor in brassinosteroid signalling enhances carotenoid accumulation and fruit quality attributes in tomato. Plant Biotechnol. J., 2014. 12(1): p. 105-15 [PMID:24102834] Kim B, et al. Darkness and gulliver2/phyB mutation decrease the abundance of phosphorylated BZR1 to activate brassinosteroid signaling in Arabidopsis. Plant J., 2014. 77(5): p. 737-47 [PMID:24387668] He X, et al. A genotypic difference in primary root length is associated with the inhibitory role of transforming growth factor-beta receptor-interacting protein-1 on root meristem size in wheat. Plant J., 2014. 77(6): p. 931-43 [PMID:24467344] Oh E, et al. Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl. Elife, 2015. [PMID:24867218] Zhang D,Jing Y,Jiang Z,Lin R The Chromatin-Remodeling Factor PICKLE Integrates Brassinosteroid and Gibberellin Signaling during Skotomorphogenic Growth in Arabidopsis. Plant Cell, 2014. 26(6): p. 2472-2485 [PMID:24920333] Shimada S, et al. Formation and dissociation of the BSS1 protein complex regulates plant development via brassinosteroid signaling. Plant Cell, 2015. 27(2): p. 375-90 [PMID:25663622] Chaiwanon J,Wang ZY Spatiotemporal brassinosteroid signaling and antagonism with auxin pattern stem cell dynamics in Arabidopsis roots. Curr. Biol., 2015. 25(8): p. 1031-42 [PMID:25866388] Zhang Y, et al. Brassinosteroid is required for sugar promotion of hypocotyl elongation in Arabidopsis in darkness. Planta, 2015. 242(4): p. 881-93 [PMID:25998528] Jiang J, et al. The Intrinsically Disordered Protein BKI1 Is Essential for Inhibiting BRI1 Signaling in Plants. Mol Plant, 2015. 8(11): p. 1675-8 [PMID:26296798] Zhang Y,He J Sugar-induced plant growth is dependent on brassinosteroids. Plant Signal Behav, 2015. 10(12): p. e1082700 [PMID:26340221] Anne P, et al. OCTOPUS Negatively Regulates BIN2 to Control Phloem Differentiation in Arabidopsis thaliana. Curr. Biol., 2015. 25(19): p. 2584-90 [PMID:26387715] Wang R, et al. The Brassinosteroid-Activated BRI1 Receptor Kinase Is Switched off by Dephosphorylation Mediated by Cytoplasm-Localized PP2A B' Subunits. Mol Plant, 2016. 9(1): p. 148-157 [PMID:26517938] Youn JH, et al. ARF7 increases the endogenous contents of castasterone through suppression of BAS1 expression in Arabidopsis thaliana. Phytochemistry, 2016. 122: p. 34-44 [PMID:26608667] Chaiwanon J,Garcia VJ,Cartwright H,Sun Y,Wang ZY Immunophilin-like FKBP42/TWISTED DWARF1 Interacts with the Receptor Kinase BRI1 to Regulate Brassinosteroid Signaling in Arabidopsis. Mol Plant, 2016. 9(4): p. 593-600 [PMID:26808213] Yang X,Bai Y,Shang J,Xin R,Tang W The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1. Plant Cell Environ., 2016. 39(9): p. 1994-2003 [PMID:27149247] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Zhang Z, et al. TOR Signaling Promotes Accumulation of BZR1 to Balance Growth with Carbon Availability in Arabidopsis. Curr. Biol., 2016. 26(14): p. 1854-60 [PMID:27345161] Zhang Y, et al. Functional characterization of GmBZL2 (AtBZR1 like gene) reveals the conserved BR signaling regulation in Glycine max. Sci Rep, 2016. 6: p. 31134 [PMID:27498784] Salazar-Henao JE,Lehner R,Betegón-Putze I,Vilarrasa-Blasi J,Caño-Delgado AI BES1 regulates the localization of the brassinosteroid receptor BRL3 within the provascular tissue of the Arabidopsis primary root. J. Exp. Bot., 2016. 67(17): p. 4951-61 [PMID:27511026] Favero DS,Le KN,Neff MM Brassinosteroid signaling converges with SUPPRESSOR OF PHYTOCHROME B4-#3 to influence the expression of SMALL AUXIN UP RNA genes and hypocotyl growth. Plant J., 2017. 89(6): p. 1133-1145 [PMID:27984677] Li H, et al. BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis. Mol Plant, 2017. 10(4): p. 545-559 [PMID:28089951] Nolan T, et al. Identification of Brassinosteroid Target Genes by Chromatin Immunoprecipitation Followed by High-Throughput Sequencing (ChIP-seq) and RNA-Sequencing. Methods Mol. Biol., 2017. 1564: p. 63-79 [PMID:28124247] Ye H, et al. RD26 mediates crosstalk between drought and brassinosteroid signalling pathways. Nat Commun, 2017. 8: p. 14573 [PMID:28233777] Zentella R, et al. The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA. Nat. Chem. Biol., 2017. 13(5): p. 479-485 [PMID:28244988] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Li QF, et al. Light involved regulation of BZR1 stability and phosphorylation status to coordinate plant growth in Arabidopsis. Biosci. Rep., 2018. [PMID:28396515] Nolan TM, et al. Selective Autophagy of BES1 Mediated by DSK2 Balances Plant Growth and Survival. Dev. Cell, 2017. 41(1): p. 33-46.e7 [PMID:28399398] Yang M, et al. SINAT E3 Ligases Control the Light-Mediated Stability of the Brassinosteroid-Activated Transcription Factor BES1 in Arabidopsis. Dev. Cell, 2017. 41(1): p. 47-58.e4 [PMID:28399399] Thussagunpanit J, et al. Characterization of synthetic ecdysteroid analogues as functional mimics of brassinosteroids in plant growth. J. Steroid Biochem. Mol. Biol., 2017. 172: p. 1-8 [PMID:28479230] Zhu JY, et al. The F-box Protein KIB1 Mediates Brassinosteroid-Induced Inactivation and Degradation of GSK3-like Kinases in Arabidopsis. Mol. Cell, 2017. 66(5): p. 648-657.e4 [PMID:28575660] Chen J, et al. Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses. Plant Cell, 2017. 29(6): p. 1425-1439 [PMID:28576847] Yang M,Wang X Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants. Mol Plant, 2017. 10(7): p. 915-917 [PMID:28629641] Lv B, et al. Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis. PLoS Genet., 2018. 14(1): p. e1007144 [PMID:29324765] Ibañez C, et al. Brassinosteroids Dominate Hormonal Regulation of Plant Thermomorphogenesis via BZR1. Curr. Biol., 2018. 28(2): p. 303-310.e3 [PMID:29337075] Saito M,Kondo Y,Fukuda H BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation. Plant Cell Physiol., 2018. 59(3): p. 590-600 [PMID:29385529] Liang T, et al. UVR8 Interacts with BES1 and BIM1 to Regulate Transcription and Photomorphogenesis in Arabidopsis. Dev. Cell, 2018. 44(4): p. 512-523.e5 [PMID:29398622] Li QF, et al. The brassinosteroid-regulated transcription factors BZR1/BES1 function as a coordinator in multisignal-regulated plant growth. Biochim Biophys Acta Gene Regul Mech, 2018. 1861(6): p. 561-571 [PMID:29673687] Nosaki S, et al. Structural basis for brassinosteroid response by BIL1/BZR1. Nat Plants, 2018. 4(10): p. 771-776 [PMID:30287951]