PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.008G183700.2 | ||||||||
Common Name | PHAVU_008G1837001g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 227aa MW: 25856.6 Da PI: 10.0512 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85 | 4.4e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly+++s Phvul.008G183700.2 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFAS 59 8***********************************************86 PP | |||||||
2 | K-box | 85.3 | 1.3e-28 | 81 | 170 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++++ + +q+e+a L+++++nLq+++R+++Ge+L+ L++keLq+Le+qLe sl+ +R kK++ll+++i+el +k + +++en +L kk+ Phvul.008G183700.2 81 SSTSEIKFWQREAAMLRQQLHNLQESHRKIMGEELSGLTVKELQNLEKQLEISLRGVRMKKDQLLVDEIQELNRKANLISQENVELYKKV 170 678899********************************************************************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.4E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.497 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.23E-32 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.28E-43 | 2 | 74 | No hit | No description |
PRINTS | PR00404 | 8.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.0E-27 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.848 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010440 | Biological Process | stomatal lineage progression | ||||
GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFASS 60 SMKSVIDRYN KSKEENFQLG SSTSEIKFWQ REAAMLRQQL HNLQESHRKI MGEELSGLTV 120 KELQNLEKQL EISLRGVRMK KDQLLVDEIQ ELNRKANLIS QENVELYKKV YGTKDDSETN 180 RDYVLTNGLG MGEDLQLPVN LQLSQPQQQH YKAPSGISKL GRLQLH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 1e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 1e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 1e-19 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00410 | DAP | Transfer from AT3G57230 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.008G183700.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007141292.1 | 1e-165 | hypothetical protein PHAVU_008G1837001g | ||||
Swissprot | Q6EP49 | 8e-99 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
TrEMBL | V7B9Z1 | 1e-164 | V7B9Z1_PHAVU; Uncharacterized protein | ||||
STRING | XP_007141292.1 | 1e-164 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 2e-98 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.008G183700.2 |
Entrez Gene | 18623286 |
Publications ? help Back to Top | |||
---|---|---|---|
|