PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G266800.1 | ||||||||
Common Name | PHAVU_007G266800g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 212aa MW: 24085.5 Da PI: 9.124 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 66.5 | 2.6e-21 | 24 | 71 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 + +n+ n vtfskRr+gi+KKA+EL +LC++++avi+fs++ +++ + Phvul.007G266800.1 24 KMSNEHNLRVTFSKRRTGIFKKASELATLCGVDIAVIMFSPSSQIFSF 71 679**************************************9998877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.46 | 15 | 75 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.7E-29 | 15 | 74 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.05E-31 | 16 | 83 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-26 | 16 | 92 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-18 | 17 | 37 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-22 | 25 | 71 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-18 | 37 | 52 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-18 | 52 | 73 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MDSKNMAKKN LKKTRGRQKI EIKKMSNEHN LRVTFSKRRT GIFKKASELA TLCGVDIAVI 60 MFSPSSQIFS FGSPNVDPVI QRYTAQGPPP LLTLDLNEAH STVDEGELHA QLNNLSDQMT 120 AEKKHEEALK RLMKDVEEHS WWAIPMENMN DSQLEKCKKM LEDLKERVNE KREKLLLQST 180 FSYNSQTQFF TGGNSFSSVN NTETIHPPLS L* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3kov_B | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3kov_I | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3kov_J | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_A | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_B | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_C | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_D | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_I | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
3p57_J | 7e-18 | 16 | 89 | 1 | 74 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G266800.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007145776.1 | 1e-157 | hypothetical protein PHAVU_007G266800g | ||||
TrEMBL | V7BL39 | 1e-156 | V7BL39_PHAVU; Uncharacterized protein | ||||
STRING | XP_007145776.1 | 1e-157 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13864 | 5 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 6e-42 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G266800.1 |
Entrez Gene | 18627154 |